[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "pubi0:hpaG"

hpaG        "fumarylacetoacetate hydrolase family protein"
            ""

OrgPattern 11---12222222221-112111221122143-1111111111-----111111111-1112211-11 2221431222221253222-2111352222212343329A221525211222785233--113122435211111111----5-1---11111111---11221231213------------------------111-12211123-111111----------1111111--------1----2222211-31122222222422322233111122214413111111112411111111111111111111-----------11--11-----------------------------------------------------12--1-----------211---------2---1331---1-1112111--1-17111-1--1329671125344333333332332-33633533723-5337234333228553-3643233245--------221-23-2-----------------------------2-3I2-7763678A6752444277754444-464G3A6615443334225572B5331----111111111---211121--1-1-21111111111111-111112-1---1111111--1------------11--1111--2-------------------------11-------32221211221111122-2212111211212221223322222214242434444434324422122221-122233323333---1----------1125--------------1111111-1111144444326123211122-----------------------11122222222-------1----11--------------------------------------1--------11 ----222-----1113443734398872222221212333233222434976EB44543333213-1---111131111112222211-22242223222212211-121424212211--12-221217F4-3231211312311-1--2-1222214322134423233112211117111--21322221221221 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKFLRIGKAGQEIPVALDRNGKYRNLSSIIKDLNSETINFETLDKIKDINLENLEEVNQN:Sequence :cEEEEEEETTEEEEEEcTTccEEEEcccHHHHHHHHHHHccccEEEccHHHHHHHcEETT:Sec Str : XXXXXXXXXXX:SEG|50->61|nlenleevnqne :============================================================:BL:SWS|1->273|UGL_BURCM|6e-68|46.2|273/282 61: . . . * . .: 120 :ERIGSCISKPGNFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPKTSKK:Sequence :EHHHHHTTccccEEEEcccccccccccEEEEcGGGEEccccTTcHHHHcccEEEcccccc:Sec Str :X :SEG|50->61|nlenleevnqne : ===================================================:RP:SCP|70->281|1gttA1|6e-54|25.3|198/213|d.177.1.1 :============================================================:BL:SWS|1->273|UGL_BURCM|6e-68|46.2|273/282 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|77->278|PF01557|3e-39|43.2|199/213|FAA_hydrolase 121: . . + . . .: 180 :LDHEVEIAFVIGKKAKRVLEKDAQDYIFGYCICNDISEREWQKEKGGQWVKGKSGDTFGP:Sequence :EEccEEEEEEEccccccccHHHHGGGEEEEEEEEccEEHHHHHcHccccHHHHccTTcEE:Sec Str :============================================================:RP:SCP|70->281|1gttA1|6e-54|25.3|198/213|d.177.1.1 :============================================================:BL:SWS|1->273|UGL_BURCM|6e-68|46.2|273/282 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|77->278|PF01557|3e-39|43.2|199/213|FAA_hydrolase 181: . * . . . .: 240 :LGPYLVTKDEIQDVNNLNLTLDVNGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDIVT:Sequence :EEEEEEccccTTcGGccEEEEEETTEEEEEEEGGGccccHHHHHHHHHTTccccTTcEEE:Sec Str : XXXXXXXXXXXX :SEG|193->204|dvnnlnltldvn : XX:SEG|239->248|vttgtppgvg :============================================================:RP:SCP|70->281|1gttA1|6e-54|25.3|198/213|d.177.1.1 :============================================================:BL:SWS|1->273|UGL_BURCM|6e-68|46.2|273/282 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|77->278|PF01557|3e-39|43.2|199/213|FAA_hydrolase 241: + . . . . *: 300 :TGTPPGVGLGMDPPVFLKEGDEMKLNIDSLGSQNSKVILEQ :Sequence :cccccEEEEcccccccccTTcEEEEEETTTEEEEEEEEEEc :Sec Str :XXXXXXXX :SEG|239->248|vttgtppgvg :========================================= :RP:SCP|70->281|1gttA1|6e-54|25.3|198/213|d.177.1.1 :================================= :BL:SWS|1->273|UGL_BURCM|6e-68|46.2|273/282 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|77->278|PF01557|3e-39|43.2|199/213|FAA_hydrolase