[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ21597.1 pubi0 hpaG "fumarylacetoacetate hydrolase family protein"
MKFLRIGKAGQEIPVALDRNGKYRNLSSIIKDLNSETINFETLDKIKDINLENLEEVNQN
ERIGSCISKPGNFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPKTSKK
LDHEVEIAFVIGKKAKRVLEKDAQDYIFGYCICNDISEREWQKEKGGQWVKGKSGDTFGP
LGPYLVTKDEIQDVNNLNLTLDVNGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDIVT
TGTPPGVGLGMDPPVFLKEGDEMKLNIDSLGSQNSKVILEQ
//