[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "pubi0:ilvE"

ilvE        "branched-chain amino acid aminotransferase"
            ""

OrgPattern ------------------111--1211223221111111111211111111111-----------122 1121-111111-11----------1------111111132-211111211111111-111111111132-111111111111121111111-1111-111--2111-212---------------111111111112222211122311211111221111111122---1111211111211-111111-114444444554453445234443445212-2221221211212222222222222222222-1-11112-1-----11-1-1111111111111111-11--1--1--1111111111111111111111123223111121-1222-223111111-21112123211111222111--1111-111--1--2232122-2321-22222222115-22222211353-42223323323312152454444432422222222111-1124----------111111111111111----1112-21222213313241111111122221221231111122211111111221111111111111111111112221112221112111111111111-212211-212222111112111111111111111111211221111-------1112-1-11-12---1111------11121111111111111-1111111111111111111111341311111111111111111111111112-11111111111111--1111111112121111111--1111111111111111111111111111111111111111-1111111221111111111111111111111111221-111111----------1-------------------------12-1111111111 ------1---2----1---122222221111111212111-111111233227411111111111-11121111222122111122----1---------1--112-16-------------------------------------------------------------5--1-2-11P2213-8357-A5331---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MIPYDKRSGKIWFNGELVDWADAKIHVLNHGLHYASCVFEGERVYDNSIFKLEEHTSRLF:Sequence :EEEEETccccEEETTEEEcGGGccccTTcHHHHHccEEEccEEEEEETEEcHHHHHHHHH:Sec Str : ======================================================:RP:SCP|7->292|1a3gA|1e-70|36.4|275/295|e.17.1.1 :============================================================:BL:SWS|1->289|ILVE_RICCN|2e-63|44.2|283/290 : $$$$$$$$$$$:RP:PFM|50->265|PF01063|3e-29|35.2|210/220|Aminotran_4 61: . . . * . .: 120 :YSAKRMGIKIPYTEEEINLASKKIISVQGVKDGYVRPTIWRGSEMMAISAQQTKIHVAIA:Sequence :HHHHHTTccccccHHHHHHHHHHHHHHTTcccEEEEEEEEcccccccccGGGcccEEEEE:Sec Str :============================================================:RP:SCP|7->292|1a3gA|1e-70|36.4|275/295|e.17.1.1 :============================================================:BL:SWS|1->289|ILVE_RICCN|2e-63|44.2|283/290 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|50->265|PF01063|3e-29|35.2|210/220|Aminotran_4 121: . . + . . .: 180 :TWEWGSYFDPKLKIEGIKLNISNWRRPAPNTIPWDTKASGLYMICTLSKHEAEQQGYTDS:Sequence :EEEccccccTTHHHHcEEEEEcccccccTTTccTTcccGGGHHHHHHHHHHHHHTTccEE:Sec Str :============================================================:RP:SCP|7->292|1a3gA|1e-70|36.4|275/295|e.17.1.1 :============================================================:BL:SWS|1->289|ILVE_RICCN|2e-63|44.2|283/290 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|50->265|PF01063|3e-29|35.2|210/220|Aminotran_4 181: . * . . . .: 240 :LMLDHEGNVAEATGANIFFKDKNGEIHTPIPDSFLDGITRRTVIEIAKSKGIKVNERKIA:Sequence :EEEcTTccEEEEcccEEEEEGETTEEEEEccTTccccHHHHHHHHHHHHTTcEEEEEccc:Sec Str : ############################## :PROS|191->220|PS00770|AA_TRANSFER_CLASS_4|PDOC00618| :============================================================:RP:SCP|7->292|1a3gA|1e-70|36.4|275/295|e.17.1.1 :============================================================:BL:SWS|1->289|ILVE_RICCN|2e-63|44.2|283/290 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|50->265|PF01063|3e-29|35.2|210/220|Aminotran_4 241: + . . . . *: 300 :PAELSNFVGCFLTGTAAEVTPVSCIAENKFKVCETIIDLNESYQALVRKRKAA :Sequence :HHHHHTccEEEEEETTTEEEEEEEETTEEccccHHHHHHHHHHHHHHTTccGG :Sec Str :==================================================== :RP:SCP|7->292|1a3gA|1e-70|36.4|275/295|e.17.1.1 :================================================= :BL:SWS|1->289|ILVE_RICCN|2e-63|44.2|283/290 :$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|50->265|PF01063|3e-29|35.2|210/220|Aminotran_4