[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ20910.1 pubi0 ilvE "branched-chain amino acid aminotransferase"
MIPYDKRSGKIWFNGELVDWADAKIHVLNHGLHYASCVFEGERVYDNSIFKLEEHTSRLF
YSAKRMGIKIPYTEEEINLASKKIISVQGVKDGYVRPTIWRGSEMMAISAQQTKIHVAIA
TWEWGSYFDPKLKIEGIKLNISNWRRPAPNTIPWDTKASGLYMICTLSKHEAEQQGYTDS
LMLDHEGNVAEATGANIFFKDKNGEIHTPIPDSFLDGITRRTVIEIAKSKGIKVNERKIA
PAELSNFVGCFLTGTAAEVTPVSCIAENKFKVCETIIDLNESYQALVRKRKAA
//