[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "pubi0:leuS"

leuS        "Leucyl-tRNA synthetase"
            ""

OrgPattern 333342433443333242222434433434334444443334333333333333333333322234-2 3342233333333343344-44334434434434444444222334223323434433223332243334333333334334354544222333224223232232422243333333333333344444444443333334443233433333333333333333333333333333333334234444344466666665466666644444466644445444444445444444444454444454444444444444444444444444444444444444444444544544444444444444444434444444443544333333343443444555344344444444444454444444344243333333333444444444444444434344343-4434444433434444444554334433333333333334444444433333434334444443344443444444444444444444343333333333343443443344443333322334422233333334333433333332333333322333333224333232333344444434433335142333432222232333333333344422222232332332222222222223222232212222223233323222232222222222-22322222222222222222222222222222222222222222222222222222222222222333322222222222223222233232323222333433233323333333233333323332333333332333233333333333333333333333333343333123333333333444344-44443344444444434444444443444343 3343444-83332232234434433343313334432444334233534432543354554445344513444324415443443355-3132333222223255523957696847233235576363dp62755343284252353235126435435CF58662735575364245h5664455893556597753 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MDRYNFKTVEEKWQKFWHKNKVFSSKLDKTKKKFYCLEMFPYPSGKIHMGHVRNYTIGDV:Sequence :cccccHHHHHHHHHHHHHHHTccccccccTTcEEEEEEccccccccccHHHHHHHHHHHH:Sec Str : ############ :PROS|41->52|PS00178|AA_TRNA_LIGASE_I|PDOC00161| :============================================================:RP:SCP|1->332|1f9dA|1e-47|9.7|309/629|a.102.1.2 :============================================================:BL:SWS|1->844|SYL_BARBK|0.0|50.3|839/875 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|12->647|PF00133|3e-66|39.2|518/593|tRNA-synt_1 61: . . . * . .: 120 :LARYKTLQGYNVLHPMGWDSFGMPAENAARQNNLDPKTWTESNIKTMRSQLKKLGLSIDW:Sequence :HHHHHHHTTcEEEcccccccccHHHHHHHHHTTccHHHHHHHHHHHHHHHHHHTTccccG:Sec Str :============================================================:RP:SCP|1->332|1f9dA|1e-47|9.7|309/629|a.102.1.2 :============================================================:BL:SWS|1->844|SYL_BARBK|0.0|50.3|839/875 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|12->647|PF00133|3e-66|39.2|518/593|tRNA-synt_1 121: . . + . . .: 180 :DKEISTCSEDYYKHQQEFFLDLYDKGLVYRKENYVNWDPVDETVLANEQVVDGKGWRSGA:Sequence :GGcccTTcHHHHHHHHHHHHHHHHTTcEEEEEEEEEEETTTTEEEcGGGcTTcccccTTc:Sec Str :============================================================:RP:SCP|1->332|1f9dA|1e-47|9.7|309/629|a.102.1.2 :============================================================:BL:SWS|1->844|SYL_BARBK|0.0|50.3|839/875 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|12->647|PF00133|3e-66|39.2|518/593|tRNA-synt_1 181: . * . . . .: 240 :TVERKKLNQWFFNISKFSEDLLQGLDALENWPNKVKVMQKNWIGKSFGCEVEFKIESEKP:Sequence :ccEEEEEEEEEEcGGGGHHHHHHTTTTccHccHHHHHHHHHHHccEEEEEEEEEcccccc:Sec Str :============================================================:RP:SCP|1->332|1f9dA|1e-47|9.7|309/629|a.102.1.2 :============================================================:BL:SWS|1->844|SYL_BARBK|0.0|50.3|839/875 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|12->647|PF00133|3e-66|39.2|518/593|tRNA-synt_1 241: + . . . . *: 300 :IESIKCYTTRPDTLFGFSFLALSVDHPLAKYYEEDKEFQKFREECSKTGTTEESIASAEK:Sequence :ccEEEEEEccGGGGGGccEEEEcTTcTHHHcHHHHHHHHHHHHHHHHccHHHHTTcTTcc:Sec Str :============================================================:RP:SCP|1->332|1f9dA|1e-47|9.7|309/629|a.102.1.2 :============================================================:BL:SWS|1->844|SYL_BARBK|0.0|50.3|839/875 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|12->647|PF00133|3e-66|39.2|518/593|tRNA-synt_1 301: . . . . + .: 360 :LGFKTDMIAVNPLDKNMKVPVYFANFVLMDYGLGAVFGCPAHDQRDLDFAKKYNLKITPV:Sequence :ccEEEEEEEEcTTTTccEEEEEEcTTccTTcTTcEEEEcGGGcHHHHHHHHHTTcccccc:Sec Str :================================ :RP:SCP|1->332|1f9dA|1e-47|9.7|309/629|a.102.1.2 : =====================================:RP:SCP|324->417|2a4hA1|5e-17|8.6|93/117|c.47.1.23 :============================================================:BL:SWS|1->844|SYL_BARBK|0.0|50.3|839/875 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|12->647|PF00133|3e-66|39.2|518/593|tRNA-synt_1 361: . . . * . .: 420 :VKPEKDKDFKINNEAYTGEGYLCNSDFLDGLKVPSQSIIKTIEFLEKNNLGTKKTNYRLK:Sequence :EEccccccccccccccccccEEcccGGGTTccTHHHHHHHHHHHHHHHTcEEEEEEcccc:Sec Str :========================================================= :RP:SCP|324->417|2a4hA1|5e-17|8.6|93/117|c.47.1.23 : =====:RP:SCP|416->664|1h3nA3|5e-35|37.9|248/494|c.26.1.1 :============================================================:BL:SWS|1->844|SYL_BARBK|0.0|50.3|839/875 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|12->647|PF00133|3e-66|39.2|518/593|tRNA-synt_1 421: . . + . . .: 480 :DWGISRQRYWGCPIPIAYDENDQPIKIPRDMLPVKLPEIEKLSNTGNPLDSEDNWKFFIL:Sequence :ccccEEcccccccccEEEETTTEEEEcccTTccccccccccHHHcccGGGGcHHHHEccc:Sec Str :============================================================:RP:SCP|416->664|1h3nA3|5e-35|37.9|248/494|c.26.1.1 :============================================================:BL:SWS|1->844|SYL_BARBK|0.0|50.3|839/875 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|12->647|PF00133|3e-66|39.2|518/593|tRNA-synt_1 481: . * . . . .: 540 :DGKKYRRETDTLDTFVDSSWYFLRFCSPHNLDRGFTQEEANYWMPVDQYIGGVEHAILHL:Sequence :cccEEEccccEEcHHHHTTTHHHHTTcTTcccccccHHHHHHHccccEEEEcGGGTTTHH:Sec Str :============================================================:RP:SCP|416->664|1h3nA3|5e-35|37.9|248/494|c.26.1.1 :============================================================:BL:SWS|1->844|SYL_BARBK|0.0|50.3|839/875 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|12->647|PF00133|3e-66|39.2|518/593|tRNA-synt_1 541: + . . . . *: 600 :LYSRFFMQALSYKNDDFKLKEPFDGLFTQGMVCHETYKDQNNKWLSPDEVTSEDGKKFYK:Sequence :HHHHHHHHHHHHHTTcccccccccccEEcccEEEcEEEEEEEEETTEEEccHHHHHHHEE:Sec Str :============================================================:RP:SCP|416->664|1h3nA3|5e-35|37.9|248/494|c.26.1.1 :============================================================:BL:SWS|1->844|SYL_BARBK|0.0|50.3|839/875 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|12->647|PF00133|3e-66|39.2|518/593|tRNA-synt_1 601: . . . . + .: 660 :KDNPSEKIIVGPTESMSKSKKNTIDPENIIKNYGADSVRLFILSDSPPEKDVQWSDQGML:Sequence :EEcTTccEEEEEcccccTTTTccccHHHHHHHccHHHHHHHHHccccTTccEEEcHHHHH:Sec Str :============================================================:RP:SCP|416->664|1h3nA3|5e-35|37.9|248/494|c.26.1.1 :============================================================:BL:SWS|1->844|SYL_BARBK|0.0|50.3|839/875 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|12->647|PF00133|3e-66|39.2|518/593|tRNA-synt_1 661: . . . * . .: 720 :ASFKFVQKLWTLNSKILDKIKNNDQGSEGNDLAKFTNQLINKITQNLEKFHYNVIVANFY:Sequence :HHHHHHHHHHHHHHHTHHHHHTcccccccTTHHHHHHHHHHHHHHHHHTTcHHHHHHHHH:Sec Str :==== :RP:SCP|416->664|1h3nA3|5e-35|37.9|248/494|c.26.1.1 : ========================================================:RP:SCP|665->783|1h3nA1|4e-10|18.6|118/128|a.27.1.1 :============================================================:BL:SWS|1->844|SYL_BARBK|0.0|50.3|839/875 721: . . + . . .: 780 :EMYNFLIKEIDKPIKKEILIENYKKILIVMNPFIPHFSNECLSTINENQISWPEISKEDL:Sequence :HHHHHHHHHHHHccccHHHHHHHHHHHHHHTTTcHHHHHHHHHTTccccGccccccHHHH:Sec Str : XXXXXXXXXXXXXXX :SEG|727->741|ikeidkpikkeilie :============================================================:RP:SCP|665->783|1h3nA1|4e-10|18.6|118/128|a.27.1.1 :============================================================:BL:SWS|1->844|SYL_BARBK|0.0|50.3|839/875 781: . * . . . .: 840 :IEEDINFVVQINGKKRAILKIKRDVVEKEILEIIKTNLEIEKFLKDKTIKKSIFVPNRLI:Sequence :ccccEEEEEEETTEEEEEEEEcccccHHHHHHHHTTccccHHHHHcccccEEEEETTTEE:Sec Str :=== :RP:SCP|665->783|1h3nA1|4e-10|18.6|118/128|a.27.1.1 :============================================================:BL:SWS|1->844|SYL_BARBK|0.0|50.3|839/875 841: + . . . . *: 900 :NIIL :Sequence :EEEc :Sec Str :==== :BL:SWS|1->844|SYL_BARBK|0.0|50.3|839/875