[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "pubi0:livM2"

livM2       "probable high-affinity branched-chain amino acid transport permease protein"
            ""

OrgPattern 11-----------------111122---4-12---------------1----------------3--- ---11---------1------1---2-------111-1--1---1-----------------1---2111------------2----------------------11--------------------------2---1113111-32--2-------1-11-11-1-111-1--1111--1-132-------------------------1--------21-1--------32-------------------------------------------------------------------------------------------11-2------------------1-1--1-------11--11----11---1----------11A8A2-46455411-11111-1--2342-635121-311114343211671--3151122312111111112----4-------------------------------2-----28715344463222223342222223439345212332333--45A799-31-1-1-------------1518421-312--11312121122-1--1-11-71---------1------------------11121---1------------1--1-1-----1-1------11-1-11------------------------------11111-------------------1---------111111111111--------------2112---------------------1----1----1111211112211--------------------1---------------------------------------------------------------2-2---1------ -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------3---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MGLIIFGLAGAFIFPAYKLQMSFLYILIVLAMTWDVQGGQMGYNTFGNILFFGVGMYVAS:Sequence 61: . . . * . .: 120 :STQIAMFFSLAEWTDAGGEKTFVHTVPQFFQGFGVGILLAGIIPTIIAGVIGYGILGLRG:Sequence 121: . . + . . .: 180 :HYFAICTLALGIAAGEIAGGIEIIGAGQGMTVPVWPKDLGSNASSSQFMYYLSFGLAVIT:Sequence : XXXXXXXXXXXXXXXXXXXX :SEG|128->147|lalgiaageiaggieiigag : =====:BL:SWS|176->314|LIVM_METJA|4e-06|31.6|136/345 : $$$$$$$$$:RP:PFM|172->284|PF02653|9e-09|34.9|106/271|BPD_transp_2 181: . * . . . .: 240 :FITLKWAYSTRFGLILNAIRDNEDKAEAMGIHTMRYKIIGWMVSAFFVGIAGGLMGHING:Sequence :============================================================:BL:SWS|176->314|LIVM_METJA|4e-06|31.6|136/345 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|172->284|PF02653|9e-09|34.9|106/271|BPD_transp_2 241: + . . . . *: 300 :YIEPNEIAFAGPTFGVFMVLMAILGGKGTLWGPLVGAVLFHLFKEGFWTYFLGWQYVALG:Sequence :============================================================:BL:SWS|176->314|LIVM_METJA|4e-06|31.6|136/345 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|172->284|PF02653|9e-09|34.9|106/271|BPD_transp_2 301: . . . . + .: 360 :VLIIVIVVYFPEGLMGWLREKYPERFGEVIDEADRKAQVELK :Sequence : XXXXXX :SEG|303->308|iivivv :============== :BL:SWS|176->314|LIVM_METJA|4e-06|31.6|136/345