[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ22162.1 pubi0 livM2 "probable high-affinity branched-chain amino acid transport permease protein"
MGLIIFGLAGAFIFPAYKLQMSFLYILIVLAMTWDVQGGQMGYNTFGNILFFGVGMYVAS
STQIAMFFSLAEWTDAGGEKTFVHTVPQFFQGFGVGILLAGIIPTIIAGVIGYGILGLRG
HYFAICTLALGIAAGEIAGGIEIIGAGQGMTVPVWPKDLGSNASSSQFMYYLSFGLAVIT
FITLKWAYSTRFGLILNAIRDNEDKAEAMGIHTMRYKIIGWMVSAFFVGIAGGLMGHING
YIEPNEIAFAGPTFGVFMVLMAILGGKGTLWGPLVGAVLFHLFKEGFWTYFLGWQYVALG
VLIIVIVVYFPEGLMGWLREKYPERFGEVIDEADRKAQVELK
//