[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "pubi0:lpxB"

lpxB        "lipid-A-disaccharide synthase (lpxB)"
            ""

OrgPattern -------------------------------------------------------------------- 111--------------------------------------------------------------------------------111111111-1111--111111111-111111111111111111111111111----------1211111111111-11111111111111111111111-----111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------11111111111111--1111111111111111111111-1111111111111111111111111111111111111111111111111111111------------1111111111111----1-----11111111111111111111111111111111111111111111111111111111111111111---11111111111--1111111111111111111-11111111111111111111111111111111111111111111111111111111111--11111------11111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111122221111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111----------------------------------------------111 -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2111--1---1-1- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKKIFILTGEPSGDKLASTVISKLKMNNPNIEYLSVGGTHIKKLGIKSIFDLKEITYLGF:Sequence : :Sec Str :============================================================:BL:SWS|1->356|LPXB_RICBR|2e-52|34.3|350/381 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->347|PF02684|1e-56|32.5|342/368|LpxB 61: . . . * . .: 120 :TSVLFNIFKIRKKINKTVEEIIKFNPDILFSVDSPDFTLRVAEKVKNINHNIKIIHYVAP:Sequence : :Sec Str : XXXXXXXXXXXX :SEG|65->76|fnifkirkkink : XXXXXXXXXXX :SEG|106->116|kninhnikiih :============================================================:BL:SWS|1->356|LPXB_RICBR|2e-52|34.3|350/381 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->347|PF02684|1e-56|32.5|342/368|LpxB 121: . . + . . .: 180 :QVWVWRKNRVKKIKKFIDHILLLFNFEKKYFDEENIKNTFVGHPLIEKKDNVITSLDNLI:Sequence : TTGGGGcTHHHHHHccccccTTcccGGGTTHHHHHcccccccTTccccEEcccc:Sec Str : ===================================================:RP:SCP|130->326|2a3lA1|9e-05|10.6|188/616|c.1.9.1 :============================================================:BL:SWS|1->356|LPXB_RICBR|2e-52|34.3|350/381 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->347|PF02684|1e-56|32.5|342/368|LpxB 181: . * . . . .: 240 :SKDKKIISLFPGSRKSETSVLLPILLNFIKLMNKKKLDHLFVFHATDENKEFIINKVKKT:Sequence :ccEEccccccTTHHHcccEEcccccEEccccccccccccccccccccccccccTTccccc:Sec Str :============================================================:RP:SCP|130->326|2a3lA1|9e-05|10.6|188/616|c.1.9.1 :============================================================:BL:SWS|1->356|LPXB_RICBR|2e-52|34.3|350/381 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->347|PF02684|1e-56|32.5|342/368|LpxB 241: + . . . . *: 300 :NLDNIDIISDEDIKNQVLSNSIFAVSKSGTISLQISSANIPSIIIYKLGFINFMIFKLLV:Sequence :ccccccccccccccccTTTTcccEEEccccTTccccEEEcccccccccEEcccccccHHH:Sec Str :============================================================:RP:SCP|130->326|2a3lA1|9e-05|10.6|188/616|c.1.9.1 :============================================================:BL:SWS|1->356|LPXB_RICBR|2e-52|34.3|350/381 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->347|PF02684|1e-56|32.5|342/368|LpxB 301: . . . . + .: 360 :NVRFANIINIINDKEVIPELLQKECNAEEIYKTVTYFLKNPELIEKQLVDCKKTLEGIKS:Sequence :HHHHHccccccccccccccccccTTTcTTTTTcccHHHHHHHHHHHccTTcccccc :Sec Str : XX:SEG|359->366|ksksssss :========================== :RP:SCP|130->326|2a3lA1|9e-05|10.6|188/616|c.1.9.1 :======================================================== :BL:SWS|1->356|LPXB_RICBR|2e-52|34.3|350/381 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|4->347|PF02684|1e-56|32.5|342/368|LpxB 361: . . . * . .: 420 :KSSSSSEAALILNNYLVS :Sequence : :Sec Str :XXXXXX :SEG|359->366|ksksssss