[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "pubi0:mucA"

mucA        "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ----------------------------------------------------131--------------------111----------11-1--11-----1----2-1---------------1---11111121----------3--------11111111-1------111111111111-----------111111111111111------111---------------------------------------------------------------------------------------------------------1--11---------11-111111-11-------11-----------1---------------1------------------------12-11411---------------------------------------1----1----------------11-------------1-----1111-111111111111111111111111-1111211112----122---1-1-1411--------2-1----2--111-11111------11--------1--------------------------1-21--312-111-22521121111-11-111----121------22111311111121211-1113121111111111112531--1123212131241334224211211111-211111111211---1-----3221-2121-----1------11-21131-1---1-11211312111322224---------1-111---1-1--1----11-----------2-----------------------------------------------------1-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------1-------------------------------------------------------------------------------------1------------------------------1----------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKLTIPFYLHKAGAGFPSPATDYIEEDVDLNVHLIKNVPATFIIRVQGKSMTDVGIYDGD:Sequence : cccTTccTTcGccccccccHHHHHcccGGGEEEEEccccTTGGGTccTTc:Sec Str : ========================================================:RP:SCP|5->128|1jhcA|3e-20|29.5|122/130|b.87.1.1 : =========================================================:BL:SWS|4->125|MUCA_SALTY|2e-21|41.3|121/146 61: . . . * . .: 120 :LLVIDRSLKPKNFSTVVANVHDELVVKSFVRSKDGQFLTSGSKNIEDKIIIGDESEVFIW:Sequence :EEEEEccccccTTcEEEEEETTEEEEEEEEccccccEEEcccTTccccEEccTTccEEEE:Sec Str :============================================================:RP:SCP|5->128|1jhcA|3e-20|29.5|122/130|b.87.1.1 :============================================================:BL:SWS|4->125|MUCA_SALTY|2e-21|41.3|121/146 121: . . + . . .: 180 :GVVTYVIHSTY :Sequence :EEEEEEEc :Sec Str :======== :RP:SCP|5->128|1jhcA|3e-20|29.5|122/130|b.87.1.1 :===== :BL:SWS|4->125|MUCA_SALTY|2e-21|41.3|121/146