[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ21456.1 pubi0 mucA "hypothetical protein"
MKLTIPFYLHKAGAGFPSPATDYIEEDVDLNVHLIKNVPATFIIRVQGKSMTDVGIYDGD
LLVIDRSLKPKNFSTVVANVHDELVVKSFVRSKDGQFLTSGSKNIEDKIIIGDESEVFIW
GVVTYVIHSTY
//