[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "pubi0:nrdB"

nrdB        "ribonucleoside-diphosphate reductase beta chain"
            ""

OrgPattern -------------------------111-111------------------------------------ 1---121111111111121-211112222221111111111---111111111211111111-11111111----111--1--1111111-1----1--112-1111-11111111111111111-------------------11111-111----------11-------------------1-11---111---------------111112---111-11111111111----------------11----1-11-1---1111111-1111---11111111--111111111111111111111111111111111----111111111111-1--11111--111-------------------111--111111111--1--111-1--111111111111---------1-14111111-111----111--1-----1-1111111111111-1111111111111111111111111111111111111111111111112111111111111111111111112111111111111111-111111-------111---1-------------1-------------11--111111111111111111111111211111112111-1-111111-111111-1111--111-1-1----22-1-222222222222-222222222222222222222212222222122222223221212222222-111121112211111-111111111111121111121-111-11111111111---11111111121111111111111111111111--------1--2211111111111111----------------11------------------------------------1-- --11-11---4---1---------------------------------11111111111111---111111----1111-1111------3--21--11-11-11111---131612---11--12-2--------1---1-13111---1-11111-1113-1-11-117113-2211V222-12113-112311-12 -----1-------------1---11----------1-1----------------------------------------------------------------------------------------1--------------------------------------------1-1-

Master   AminoSeq   


1: . . . . + .: 60 :MNTKIIQPPKEEIVKPQKMGLLVENPVYKPFRYPWCYDAWLTQQRIHWLPEEVPLGDDVR:Sequence : ccccccGGGcccccccHHHccccTTcccccccHHHHHHHHHHHHTcccGGGcccHHHHH:Sec Str : =================================:RP:SCP|28->303|1syyA|9e-68|29.7|273/317|a.25.1.2 : ========================================:BL:SWS|21->332|RIR2_IIV3|2e-79|47.3|311/376 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|27->302|PF00268|7e-40|35.6|267/277|Ribonuc_red_sm 61: . . . * . .: 120 :DWQKNLTQSEKNLLTQIFRFFTQADVEVQNCYLRHYTTVFKPTEVLMMMTAFASMETVHI:Sequence :HHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHcccHHHHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|28->303|1syyA|9e-68|29.7|273/317|a.25.1.2 :============================================================:BL:SWS|21->332|RIR2_IIV3|2e-79|47.3|311/376 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|27->302|PF00268|7e-40|35.6|267/277|Ribonuc_red_sm 121: . . + . . .: 180 :AAYSHLLDTIGMPESEYSAFMKYKEMKDKYDYMQNFDMSSKKDIALTVAVFSAFTEGLQL:Sequence :HHHHHHHHHHTccHHHHTHHHHcHHHHHHHHHHHHHHTGHHHHHHHHHHHHHTTcccccT:Sec Str : XXXXXXXXXXXXX :SEG|141->153|mkykemkdkydym :============================================================:RP:SCP|28->303|1syyA|9e-68|29.7|273/317|a.25.1.2 :============================================================:BL:SWS|21->332|RIR2_IIV3|2e-79|47.3|311/376 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|27->302|PF00268|7e-40|35.6|267/277|Ribonuc_red_sm 181: . * . . . .: 240 :FASFAILLNFPRHNKMKGMGQIVTWSVRDETLHCNSMIRLFKEFIHENPEIWTPELKAEL:Sequence :HHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcGGGccHHHHHHH:Sec Str :============================================================:RP:SCP|28->303|1syyA|9e-68|29.7|273/317|a.25.1.2 :============================================================:BL:SWS|21->332|RIR2_IIV3|2e-79|47.3|311/376 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|27->302|PF00268|7e-40|35.6|267/277|Ribonuc_red_sm 241: + . . . . *: 300 :YKACRTIIEHEDAFIDLAFEMGPMQGLTAQDVKLYIRFIANRRLSQLGLEPIYDVDKNPL:Sequence :HHHHHHHHHHHHHHHHHHcccccTTTccHHHHHHHHHHHHHHHHHHTTcccccccTcccc:Sec Str :============================================================:RP:SCP|28->303|1syyA|9e-68|29.7|273/317|a.25.1.2 :============================================================:BL:SWS|21->332|RIR2_IIV3|2e-79|47.3|311/376 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|27->302|PF00268|7e-40|35.6|267/277|Ribonuc_red_sm 301: . . . . + .: 360 :TWLDSMLNAVEHMNFFEGRSTEYSKAATQGTWTEAFS :Sequence :TTcHTHHHHTcccccccTTTTcTTc :Sec Str :=== :RP:SCP|28->303|1syyA|9e-68|29.7|273/317|a.25.1.2 :================================ :BL:SWS|21->332|RIR2_IIV3|2e-79|47.3|311/376 :$$ :RP:PFM|27->302|PF00268|7e-40|35.6|267/277|Ribonuc_red_sm