[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "pubi0:parB"

parB        "chromosome partitioning protein"
            ""

OrgPattern -------------1----------------------------------------------------11 3311111111111111112-111111111111111121111111111111112211111111111111211111121111111--1--2312-1111--111111111111111111111111111111111111122223---224231-------------1--1231-------------45322111222222222222222222222222222222222222222223222222222222222222221222222222222222222111111111111111111111111111111111111131111111111111223222222222224222221111221111511112212321122221--111111111111-11121111111111111111112-221111121121311222121111111112111211111222222221111112111-11111111111111121111111-11113511111114222222222233122222122431233114312124215221111111121111111111213131221-1111111111112111212131111-1111111111111111111111111123121121111111111111111111111111--12111---------------------------------------------1----------------1---------------111-11-11-----133313232212111---------------1121211111111111111311111121111111111112111111111111111211111112223--114433431111111121------------------------------------211 -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------2---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MDANKIKKGLGRGLSSLIGETKVEINVNKVSISDLVRNKFQPRKTFDAESLQDLTNSIKE:Sequence : cccccEEEEEEEGGGEEccccccccHccHHHHHHHHHHHHH:Sec Str : ====================================:RP:SCP|25->223|1vk1A|3e-44|19.2|198/232|d.268.1.2 : ======================================================:BL:SWS|7->279|PARB_PSEPU|5e-51|40.2|271/290 : $$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|38->116|PF02195|8e-15|46.1|76/89|ParBc 61: . . . * . .: 120 :RGIIQPIIVRRSSEDNSKYEIIAGERRWLSAQKAGLHEVPVVITNIDDLKSLEFAIIENV:Sequence :cGGGcccEEEEEETccEEEEccccHHHHHHHHHTTccEEEEEEEEEcHHHHHHGGGcccc:Sec Str :============================================================:RP:SCP|25->223|1vk1A|3e-44|19.2|198/232|d.268.1.2 :============================================================:BL:SWS|7->279|PARB_PSEPU|5e-51|40.2|271/290 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|38->116|PF02195|8e-15|46.1|76/89|ParBc 121: . . + . . .: 180 :QRNDLNVIEEAQGYQRLIEEFSYDQEKVAQFIGKSRSHIANCLRLLNLPQAVLKLIQTQK:Sequence :ccTTccHHHcccHHHHHHHHTTccHHHHHHHHTccHHHHHHHTTcccccHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|25->223|1vk1A|3e-44|19.2|198/232|d.268.1.2 :============================================================:BL:SWS|7->279|PARB_PSEPU|5e-51|40.2|271/290 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|140->186|PF08535|9e-06|48.9|47/84|KorB 181: . * . . . .: 240 :LSAGHAKILVGLDNAEFVANKIIEKNLSVRQSENFVKIFKTKKHSLKTSKDINLQVLENS:Sequence :HHcccccccccccccGHHHHHHHHTTccHHHHH :Sec Str :=========================================== :RP:SCP|25->223|1vk1A|3e-44|19.2|198/232|d.268.1.2 :============================================================:BL:SWS|7->279|PARB_PSEPU|5e-51|40.2|271/290 :$$$$$$ :RP:PFM|140->186|PF08535|9e-06|48.9|47/84|KorB 241: + . . . . *: 300 :IREKIGLNVLIKNKKNNSGSLLLEYKDLDQLNKIIEIIKSNY :Sequence : :Sec Str :======================================= :BL:SWS|7->279|PARB_PSEPU|5e-51|40.2|271/290