[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ21176.1 pubi0 parB "chromosome partitioning protein"
MDANKIKKGLGRGLSSLIGETKVEINVNKVSISDLVRNKFQPRKTFDAESLQDLTNSIKE
RGIIQPIIVRRSSEDNSKYEIIAGERRWLSAQKAGLHEVPVVITNIDDLKSLEFAIIENV
QRNDLNVIEEAQGYQRLIEEFSYDQEKVAQFIGKSRSHIANCLRLLNLPQAVLKLIQTQK
LSAGHAKILVGLDNAEFVANKIIEKNLSVRQSENFVKIFKTKKHSLKTSKDINLQVLENS
IREKIGLNVLIKNKKNNSGSLLLEYKDLDQLNKIIEIIKSNY
//