[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "pubi0:pepA"

pepA        "leucyl aminopeptidase"
            ""

OrgPattern 11-111-----------------------------------------------------------111 111111111112-211111-111111111111111111112222231121111111111122212221112-----------111111-----------1-------1--11111111111111111111-11111111111111111111111111111111111111111111111111111-111-----11111111111111111111111111111-11------11-1111111111111-11111-----------------------------------------------------------------------11-1-----------1---11111---1-------------------1-1-1233311111222222222222222222222222-222222222321222222222222222322232222222222222222222232311111111111111111111111111111122232111111111111111111111111111111111111111111121111111122121111-1111222112211-1-111-111111-1-1111-111112111111111111111111111111111114422112325244444234444444544451-1111211-11133222322222222222-2222222222222222222222222222222222222222222322222222122222222222211121111122221111122222222122223211111111111111111111111111111222222222122232222222222222222222222221111111111--------1---1-13-2221211111221122111----------1-- 1211113-843-223-----------------------------------------------------------------------11-141-113----1113231262548333321-2222231425R21325122-212211222-22122332244212333G55422342212B222113223-312252228 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTIQINYKKISSKKDLANLVLFVDEKFNINNLKKYLSNLEFSYISDLLKNSDLKKDLLSF:Sequence : :Sec Str : XXXXXXXXXXXXXXX :SEG|45->59|sdllknsdlkkdlls 61: . . . * . .: 120 :EVNSKKTVFLVSIKKDIKISDIENLGAKFHSYINNDKKKEYFVNSDTINNKIKNFVGYFL:Sequence : :Sec Str : XXXXXXXXXXX :SEG|72->82|sikkdikisdi : ====================================:BL:SWS|85->485|AMPA_EHRRG|e-113|57.3|396/500 121: . . + . . .: 180 :HGLKLKSYEFNIYKSKKNKETVLINVIGNKNKISIQDHLRFKALEEGSFFARDLVSEPGN:Sequence : HHHHHHccccTTccccccccEEEEcEEEEccccHHHHHHHHHHHHHHHHHHHHHHccTT:Sec Str : =================:RP:SCP|164->485|1bllE2|e-119|38.4|320/325|c.56.5.3 :============================================================:BL:SWS|85->485|AMPA_EHRRG|e-113|57.3|396/500 : $$$$$$$$$$:RP:PFM|171->478|PF00883|4e-84|53.0|302/305|Peptidase_M17 181: . * . . . .: 240 :VLHPDEYAKRINTLKKFGLKINIYDEKKLKKLGMNALLGVGQGSIRGSYLVTMEWNGAKN:Sequence :TccHHHHHHHHHHHHHHcccEEEEcHHHHHHTTcHHHHHHHTTcccccEEEEEEEEcccc:Sec Str :============================================================:RP:SCP|164->485|1bllE2|e-119|38.4|320/325|c.56.5.3 :============================================================:BL:SWS|85->485|AMPA_EHRRG|e-113|57.3|396/500 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|171->478|PF00883|4e-84|53.0|302/305|Peptidase_M17 241: + . . . . *: 300 :NSNPLAFVGKGVCFDTGGYSLKPAKFMEDMTYDMAGSATVVGLMKNLAIRKAKINAVGVV:Sequence :TcccEEEEEcEEEEEccTTcccccTTGGGGGGTTHHHHHHHHHHHHHHHTTcccEEEEEE:Sec Str :============================================================:RP:SCP|164->485|1bllE2|e-119|38.4|320/325|c.56.5.3 :============================================================:BL:SWS|85->485|AMPA_EHRRG|e-113|57.3|396/500 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|171->478|PF00883|4e-84|53.0|302/305|Peptidase_M17 301: . . . . + .: 360 :GLVENMVSGNAQRPGDIVKSYSGKTIEVLNTDAEGRLVLADALTFTEKKFKPKFMVDLAT:Sequence :EEEEEcccTTcccTTEEEEcTTccEEEEccTTcHHHHHHHHHHHHGHGGGcccEEEEEEc:Sec Str : ######## :PROS|330->337|PS00631|CYTOSOL_AP|PDOC00548| :============================================================:RP:SCP|164->485|1bllE2|e-119|38.4|320/325|c.56.5.3 :============================================================:BL:SWS|85->485|AMPA_EHRRG|e-113|57.3|396/500 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|171->478|PF00883|4e-84|53.0|302/305|Peptidase_M17 361: . . . * . .: 420 :LTGAIIVSLGSEYAGLFSNDDKLSKQLLEAGDKVEEKLWRMPLHKNFDKLIDSKNADMQN:Sequence :ccHHHHHHTTTccEEEEEccHHHHHHHHHHHHHHcccEEEccccHHHHHHHccccccEEc:Sec Str : ################## :PROS|397->414|PS00214|FABP|PDOC00188| :============================================================:RP:SCP|164->485|1bllE2|e-119|38.4|320/325|c.56.5.3 :============================================================:BL:SWS|85->485|AMPA_EHRRG|e-113|57.3|396/500 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|171->478|PF00883|4e-84|53.0|302/305|Peptidase_M17 421: . . + . . .: 480 :INYVGGAGSTTAAQFLQRFILNKTPWAHLDIAGMAFSKYGGALNSGGATSYGVRLLNQLI:Sequence :cccccccHHHHHHHHHHTTcHccccEEEEEcGGGcEEccccTTcccEEccTTHHHHHHHH:Sec Str :============================================================:RP:SCP|164->485|1bllE2|e-119|38.4|320/325|c.56.5.3 :============================================================:BL:SWS|85->485|AMPA_EHRRG|e-113|57.3|396/500 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|171->478|PF00883|4e-84|53.0|302/305|Peptidase_M17 481: . * . . . .: 540 :EDNYE :Sequence :HHHHc :Sec Str :===== :RP:SCP|164->485|1bllE2|e-119|38.4|320/325|c.56.5.3 :===== :BL:SWS|85->485|AMPA_EHRRG|e-113|57.3|396/500