[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "pubi0:polA"

polA        "DNA polymerase I"
            ""

OrgPattern -------------------------------------------------------------------- 1221211111111122222-22112222222222222222212222121111222111112231222222111111111111222222111111111--1111111111111111111111111111111111111111111111112111111111111111111111111111111111112111111112222222332222222222222222321132142222222222222222222222222222111111112111111121111111111111111111111111111111111211111111111111111112112111111111111221111112112212122212111111111111111111111111111111111111111111111111-111131111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1121111111111121111112112211111111111111111111111111111111111222111222122122111111111111111111111111111112221122112222222222222222222221-1111211111122222222221222222-22222222222222222222222222222222222222322222222222221233323323222111111111111111112111111111111111111111111111111111111111111111111111111222222222222222222222222111111111111111111111111111112-11211111111211111111111111111111 33--431-B55---1---------------------------------------------------------------------------------------------42511222-2121222572516F2-4251112222211221122-72131212112212111311212244K4444264A7-552332111 -------1----------------------------------------------11-----------1-1-------------------11-----1-----------------1-----------------------1----------1-1--------1--------------

Master   AminoSeq   


1: . . . . + .: 60 :MDKIKKTDHFYLIDGSGYIFRAYYALPPLTRKSDGLPVGAVSGFCSMLFKLLEDSKSNEN:Sequence : cccTTcccccccTHHHHTTcccTTcccccccccccccTTHHHHHHHGGGTcHHHGG:Sec Str : ====================================================:RP:SCP|9->178|1exnA2|1e-36|21.4|154/166|c.120.1.2 : ======================================================:BL:SWS|7->924|DPO1_HAEIN|0.0|39.4|900/930 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->178|PF02739|2e-47|56.4|163/165|5_3_exonuc_N 61: . . . * . .: 120 :LQKPTHFAVIFDAARKTFRNEIYSDYKANRSEAPDDLAPQFEYIRKSVVAFNLPSVDLPN:Sequence :GcccccccccccccccccccGGGGTTTcccccccTTcTTGGGTHHHHHHHTTcccccccc:Sec Str :============================================================:RP:SCP|9->178|1exnA2|1e-36|21.4|154/166|c.120.1.2 :============================================================:BL:SWS|7->924|DPO1_HAEIN|0.0|39.4|900/930 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->178|PF02739|2e-47|56.4|163/165|5_3_exonuc_N 121: . . + . . .: 180 :YEADDLIATYVEQILAKGAKVTIVSSDKDLMQLYRKDVRIFDPMKNKFITPEDIVTKFGV:Sequence :ccHHHHHHHHHHHHHHHTcccccccccTTccTTccTTcccccccccccEccTTHHHHTcc:Sec Str :========================================================== :RP:SCP|9->178|1exnA2|1e-36|21.4|154/166|c.120.1.2 :============================================================:BL:SWS|7->924|DPO1_HAEIN|0.0|39.4|900/930 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|8->178|PF02739|2e-47|56.4|163/165|5_3_exonuc_N : $:RP:PFM|180->271|PF01367|1e-23|55.4|92/100|5_3_exonuc 181: . * . . . .: 240 :GPEKVIDVQSLAGDSSDNVPGVPGIGVKTAAELINKYGTLEKLLDNAQEIKQNKRRETLI:Sequence :cGGGTTTTTTccccccccccccccccccTTTTTGGGTTcccccccccccccTHTTcHHHH:Sec Str : ================================== :RP:SCP|196->229|2a1jA1|9e-06|20.6|34/62|a.60.2.5 : ============:RP:SCP|229->546|2hbjA2|7e-42|12.5|289/292|c.55.3.5 :============================================================:BL:SWS|7->924|DPO1_HAEIN|0.0|39.4|900/930 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|180->271|PF01367|1e-23|55.4|92/100|5_3_exonuc 241: + . . . . *: 300 :ENKDKAIISKKLVTLMKDAPVERKLEEFHLKKIDKNKLYKFLREMEFNRLLSSVISAYGE:Sequence :cccccTTcGGGccccccccccccccccTccccccHHHHHHHHTTTTcccTTTc :Sec Str :============================================================:RP:SCP|229->546|2hbjA2|7e-42|12.5|289/292|c.55.3.5 :============================================================:BL:SWS|7->924|DPO1_HAEIN|0.0|39.4|900/930 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|180->271|PF01367|1e-23|55.4|92/100|5_3_exonuc 301: . . . . + .: 360 :PLLEETAKETKPEKKHQNISKKNYHLITNEKEIDEWINEAEEAGELAIDTETSSLDAHQT:Sequence : ccccccccEEcccccTcGGGTTccccccccccccEEEcccccTT:Sec Str : XXXXXXXXXXXX :SEG|304->315|eetaketkpekk :============================================================:RP:SCP|229->546|2hbjA2|7e-42|12.5|289/292|c.55.3.5 :============================================================:BL:SWS|7->924|DPO1_HAEIN|0.0|39.4|900/930 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|327->500|PF01612|3e-26|43.7|158/171|3_5_exonuc 361: . . . * . .: 420 :DLVGISLSTKIGQACYIPIGHKFKGCLKKETVIKKLKPLLEDKSVKKIGQNIKFDFIVLY:Sequence :cccEEEcccccTTTccccEEEcccccEETcEEEccccHHHHHHHccccccTTHHHHHHHH:Sec Str :============================================================:RP:SCP|229->546|2hbjA2|7e-42|12.5|289/292|c.55.3.5 :============================================================:BL:SWS|7->924|DPO1_HAEIN|0.0|39.4|900/930 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|327->500|PF01612|3e-26|43.7|158/171|3_5_exonuc 421: . . + . . .: 480 :KQGINMNSMEDTMLMSYVLDAGKNRHNMDTLSEIHLQHKTISFKEIVGTGKKEINFSDVE:Sequence :HHHccccccccHHHHHHHHcTTcccccTTHHHHHHcccccccHHHHHccGGGcccccHcc:Sec Str :============================================================:RP:SCP|229->546|2hbjA2|7e-42|12.5|289/292|c.55.3.5 :============================================================:BL:SWS|7->924|DPO1_HAEIN|0.0|39.4|900/930 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|327->500|PF01612|3e-26|43.7|158/171|3_5_exonuc 481: . * . . . .: 540 :LDKAMEYAAEDADITYRLYKIFSKNLKLEKLTNIYEIFEKPLIKILAFMEIEGIKIDNKF:Sequence :HHcccccHHHHHHHHHHHHHHHHHHTTcHHHHHHHHTTHHHHHHHHHHHHHHcccccTTT:Sec Str :============================================================:RP:SCP|229->546|2hbjA2|7e-42|12.5|289/292|c.55.3.5 : ================================:RP:SCP|509->924|1bgxT4|e-126|40.7|403/406|e.8.1.1 :============================================================:BL:SWS|7->924|DPO1_HAEIN|0.0|39.4|900/930 :$$$$$$$$$$$$$$$$$$$$ :RP:PFM|327->500|PF01612|3e-26|43.7|158/171|3_5_exonuc 541: + . . . . *: 600 :LKVLSEKFEKKISKLEKEVFKISKKEFNIASPKQLGEIIYNDLKIAVLKKTRKGSFATNA:Sequence :HHHHHHHHHHHHHHHHHHHHHccccccccccHHHHTTTTTTcccccccccccccccGGGT:Sec Str :====== :RP:SCP|229->546|2hbjA2|7e-42|12.5|289/292|c.55.3.5 :============================================================:RP:SCP|509->924|1bgxT4|e-126|40.7|403/406|e.8.1.1 :============================================================:BL:SWS|7->924|DPO1_HAEIN|0.0|39.4|900/930 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|549->922|PF00476|e-105|51.9|360/360|DNA_pol_A 601: . . . . + .: 660 :SVLEDLAFKGHEFPKLILDWRQVSKLKNTYSDALPEHINPNTKRVHTSFLLAATTTGRLA:Sequence :cTTTTGGGTGccTTHHHHTHHHHccccTTccccTTTcccTTTcccccEEEcccccccccE:Sec Str :============================================================:RP:SCP|509->924|1bgxT4|e-126|40.7|403/406|e.8.1.1 :============================================================:BL:SWS|7->924|DPO1_HAEIN|0.0|39.4|900/930 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|549->922|PF00476|e-105|51.9|360/360|DNA_pol_A 661: . . . * . .: 720 :SSDPNLQNIPIKSEDGKDIRKAFIAEKGFTLISADYNQIEMRILADLAEVKELKKAFSNN:Sequence :EEcccTTccccccTTTTTTGGGccccccccEEEEEEccHHHHHHHHTTTcTTHHHHHHHT:Sec Str :============================================================:RP:SCP|509->924|1bgxT4|e-126|40.7|403/406|e.8.1.1 :============================================================:BL:SWS|7->924|DPO1_HAEIN|0.0|39.4|900/930 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|549->922|PF00476|e-105|51.9|360/360|DNA_pol_A 721: . . + . . .: 780 :EDIHSLTASQVFNVDIKKVDQDMRRKAKAINFGIIYGISQYGLAKQINVSNHEADEFLNA:Sequence :ccHHHHHHHHHHTccTTcccTTHHHHHHHHHHHTTccccHHHHHHHccccHHHHHHHHHH:Sec Str : #################### :PROS|744->763|PS00447|DNA_POLYMERASE_A|PDOC00412| :============================================================:RP:SCP|509->924|1bgxT4|e-126|40.7|403/406|e.8.1.1 :============================================================:BL:SWS|7->924|DPO1_HAEIN|0.0|39.4|900/930 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|549->922|PF00476|e-105|51.9|360/360|DNA_pol_A 781: . * . . . .: 840 :YFLKFPEIKIYMDNTIKFCRKSGYVTNIFGRRSHFNGINDKNFNVRNFQERAAINAPIQG:Sequence :HHHHcHHHHHHHHHHTHHHHTTcccccccccccccGGGccccHHHHHHHHHHHTTHHHHT:Sec Str :============================================================:RP:SCP|509->924|1bgxT4|e-126|40.7|403/406|e.8.1.1 :============================================================:BL:SWS|7->924|DPO1_HAEIN|0.0|39.4|900/930 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|549->922|PF00476|e-105|51.9|360/360|DNA_pol_A 841: + . . . . *: 900 :SASEIMRLAMIRLNKKFESIKNNKSKILLQIHDELIFEVPVKEVKNITEIIKDEMTSVTE:Sequence :HHHHHHHTHHHHHHHHHHHTTHHTcEEEEEETTEEEEEccHHHHHHHHHHHHcccHTccc:Sec Str :============================================================:RP:SCP|509->924|1bgxT4|e-126|40.7|403/406|e.8.1.1 :============================================================:BL:SWS|7->924|DPO1_HAEIN|0.0|39.4|900/930 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|549->922|PF00476|e-105|51.9|360/360|DNA_pol_A 901: . . . . + .: 960 :SDLHTFSTPLTVDVNTGDNWGILH :Sequence :HHTccccccccEEccEEccHHHHc :Sec Str :======================== :RP:SCP|509->924|1bgxT4|e-126|40.7|403/406|e.8.1.1 :======================== :BL:SWS|7->924|DPO1_HAEIN|0.0|39.4|900/930 :$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|549->922|PF00476|e-105|51.9|360/360|DNA_pol_A