[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "pubi0:recR"

recR        "recR-like protein"
RECR_PELUB  "RecName: Full=Recombination protein recR;"

OrgPattern -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111--1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--11111111-1111-111111111111111111111111111111111-111111111111111111111111111111111111111111111--11111------11111111111111111-1111111111111-11111111111111111111111111111111111111-111111111111--11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--11111111---1-111111---11-1-1111-111111-11111----------111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------1------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MQNINEIEELIKLISKLPGLGPKSAKRIVLKLINNRDELVKPMANTLAQVYKNVIRCQSC:Sequence : TTccHHHHHHHTTTTcccHHHHHHTGGGccHHHHHHHHTTTGE:Sec Str : XXXXXXXXXXXXXXX :SEG|3->17|nineieelikliskl : ===========================================:RP:SCP|18->195|1vddA|1e-24|34.9|175/199|e.49.1.1 : ===========================================:BL:SWS|18->203|RECR_PELUB|4e-97|100.0|186/203 61: . . . * . .: 120 :GTLKSNSLGCNNCENSKEKYNKICVVEDIADQWSIENSNIYKGYFHILGGTISSAGQRKE:Sequence :EEccEHHHHHHHGGGccTTEEEEEcccccEEccccccHHHHHHHTEETTTTTEEccEEcT:Sec Str :============================================================:RP:SCP|18->195|1vddA|1e-24|34.9|175/199|e.49.1.1 :============================================================:BL:SWS|18->203|RECR_PELUB|4e-97|100.0|186/203 121: . . + . . .: 180 :DLLINSLVERVSRENIEEVILATSATVEGQTTAYYIEDSLKKTSTKVTKLAQGLPVGGEI:Sequence :TcHHHHHHHHHHHHTEEEEEEcccccHHHHHHHHHHHHHHcccGGGEEEcccccccHHHH:Sec Str : XXXXXXXXXXXX :SEG|159->170|slkktstkvtkl :============================================================:RP:SCP|18->195|1vddA|1e-24|34.9|175/199|e.49.1.1 :============================================================:BL:SWS|18->203|RECR_PELUB|4e-97|100.0|186/203 181: . * . . . .: 240 :ESLDDGTLYSAFKNRTGIKTNSD :Sequence :HccccHHHHHHHHHHHHHH :Sec Str :=============== :RP:SCP|18->195|1vddA|1e-24|34.9|175/199|e.49.1.1 :======================= :BL:SWS|18->203|RECR_PELUB|4e-97|100.0|186/203