[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ21331.1 pubi0 recR "recR-like protein"
MQNINEIEELIKLISKLPGLGPKSAKRIVLKLINNRDELVKPMANTLAQVYKNVIRCQSC
GTLKSNSLGCNNCENSKEKYNKICVVEDIADQWSIENSNIYKGYFHILGGTISSAGQRKE
DLLINSLVERVSRENIEEVILATSATVEGQTTAYYIEDSLKKTSTKVTKLAQGLPVGGEI
ESLDDGTLYSAFKNRTGIKTNSD
//