[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "pubi0:ribA"

ribA        "GTP cyclohydrolase II /3,4-dihydroxy-2-butanone 4-phosphate synthase"
            ""

OrgPattern -----------------------1-----1---11111-----121--11-----------------1 1111111111121111122-2111212222222111114311111-111111-111111111111221111----1-----12111111212-111---1121111111111111111111111111121111121111-111111111111211111111111111111111111111111111111---1111111111111111111111111111111111------1111111111111111111111--1----2---1111----111-111111-------11111111111-----------------------11-11222211311111111111-111--1111111211211111-1-11111-111111112111111111111-1111111111-11111111111112211212221111111112111111111111111111111121111111111---------------111111332122222233323122222222222222333333211222211221111111111111211111111111111122121222222221212311122111112112111111111111111111111111222231111112122222122222222222221-1111111-11111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111121-11121111111111122222221112111113122233331222111111111111122222232222111111111111111111111111----------1-------------------------11-111-111111 ------1-----1111112111111111111111111111111111111111111111111111111111111111111111111111-11111111111121111-12-------------------------------------------------1----1-----------111181111113361321132221 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKKNNYASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLIC:Sequence : ccTHHHHHHHHHHHTcccEEEEccccccccccccccTTcccHHHHHHHHHHcccccE:Sec Str : =======================================================:RP:SCP|6->202|1g57A|4e-72|39.4|193/205|d.115.1.2 : =======================================================:BL:SWS|6->363|RIBBA_AQUAE|1e-63|41.0|356/406 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|9->202|PF00926|1e-49|51.0|194/194|DHBP_synthase 61: . . . * . .: 120 :LALDSVQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRAKTIKIASKKNAN:Sequence :EEEcHHHHHHTTccccccccTTccccccccccccTTTccccccTTHHHHHHHHHTccccc:Sec Str : XXXXXXXXXXXXX:SEG|108->122|aktikiaskknankk :============================================================:RP:SCP|6->202|1g57A|4e-72|39.4|193/205|d.115.1.2 :============================================================:BL:SWS|6->363|RIBBA_AQUAE|1e-63|41.0|356/406 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|9->202|PF00926|1e-49|51.0|194/194|DHBP_synthase 121: . . + . . .: 180 :KKDIVSPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQD:Sequence :ccccccccccEEEEcccccTTccccccHHHHHHHHTTTccccccccccccTTcccccHHH:Sec Str :XX :SEG|108->122|aktikiaskknankk :============================================================:RP:SCP|6->202|1g57A|4e-72|39.4|193/205|d.115.1.2 :============================================================:BL:SWS|6->363|RIBBA_AQUAE|1e-63|41.0|356/406 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|9->202|PF00926|1e-49|51.0|194/194|DHBP_synthase 181: . * . . . .: 240 :LFDFANKHNLKIGKIEDLIAYRLKKEKLIKLKKQSDIKVKNQKYKIRIYENLLDGSEHFA:Sequence :HHHHHHHHHcEEEEcHHHHHHH EEEEEEETTTccEEEE:Sec Str : XXXXXXXXXXX :SEG|203->213|lkkekliklkk :====================== :RP:SCP|6->202|1g57A|4e-72|39.4|193/205|d.115.1.2 : ================:RP:SCP|225->366|2bz0A1|1e-17|20.9|139/168|c.144.1.1 :============================================================:BL:SWS|6->363|RIBBA_AQUAE|1e-63|41.0|356/406 :$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|9->202|PF00926|1e-49|51.0|194/194|DHBP_synthase : $$$$$$$$$$$$$$$$$$:RP:PFM|223->363|PF00925|2e-11|30.4|138/169|GTP_cyclohydro2 241: + . . . . *: 300 :LIKGNIKKGIIPRVRVISSNVVQNYLINQQLPNSFDKTLNYFKKFNNCVLVFIKDTNLKS:Sequence :EEEccccccccEEEEEccHHHHTcccccccHHHHHHHHHHHHHHHTcEEEEEEccTTTTT:Sec Str :============================================================:RP:SCP|225->366|2bz0A1|1e-17|20.9|139/168|c.144.1.1 :============================================================:BL:SWS|6->363|RIBBA_AQUAE|1e-63|41.0|356/406 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|223->363|PF00925|2e-11|30.4|138/169|GTP_cyclohydro2 301: . . . . + .: 360 :VTQTLKDYKNKNFYKKGNDKLIRNYGIGAQIIKDLKIKNMILITKSLKKVIGLEGYDIKI:Sequence :cHHHHHHcHHHHHHTTTcccccccTHHHHHHHHHTTcccEEEEcccHHHHHHHHHTTccE:Sec Str :============================================================:RP:SCP|225->366|2bz0A1|1e-17|20.9|139/168|c.144.1.1 :============================================================:BL:SWS|6->363|RIBBA_AQUAE|1e-63|41.0|356/406 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|223->363|PF00925|2e-11|30.4|138/169|GTP_cyclohydro2 361: . . . * . .: 420 :TKQEII :Sequence :EEEEcc :Sec Str :====== :RP:SCP|225->366|2bz0A1|1e-17|20.9|139/168|c.144.1.1 :=== :BL:SWS|6->363|RIBBA_AQUAE|1e-63|41.0|356/406 :$$$ :RP:PFM|223->363|PF00925|2e-11|30.4|138/169|GTP_cyclohydro2