[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "pubi0:ribD"

ribD        "5-amino-6-(5-phosphoribosylamino)uracil reductase"
            ""

OrgPattern ----1----------------------------1---111111----------1-1-111-1------ 1111-11-11-11-11-11-1-11111111111111-111--------111111111-111111-11-1--1---1-----11111221111-111---1111111111111111111111111111111111111111--11111111111111111111111111112111111111111111111---1111111121311112111111211111111111------1111111111111111111111--1----1---1-11----111-1-1111-------11111111111-----------------------11-11111111111111111111-111--1111111111211111-1-11111----11111111111111111111111111111-11-11111111111-11111111111--11-21111111111111111--1-1111111111111---------------11111111111111111111121111111122221211111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1-11-1111111111--111-111211111111211111111111111-1111111-11111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111212111111111111111111111121111122221111111111111111111111111----------1-------------------------11-111-111111 ----------------------------------------------------------------1---------1---------1-------------------------------------------------------------------------1----------------11----1---3122-22-1----- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MELALNLAKARHGLTGINPSVGCVIVKNNKILSIGQTGFKGTPHAEFNAIKNSHENIEGS:Sequence :HHHHHHHHGGGTTccTTccccEEEEEccccEEEEEEcccTTcccHHHHHHHHHGGGGTTc:Sec Str : #################:PROS|44->82|PS00903|CYT_DCMP_DEAMINASES|PDOC00702| :============================================================:RP:SCP|1->140|1wwrA1|7e-21|26.5|132/151|c.97.1.2 :============================================================:BL:SWS|1->311|RIBD_BACSU|4e-38|32.5|308/361 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->69|PF00383|2e-06|43.3|67/100|dCMP_cyt_deam_1 61: . . . * . .: 120 :KMYVTLEPCSHYGKTPPCTNIIIKNKIKEVVYGVEDIDKKVKGKTLNILKSKNILVKKDL:Sequence :EEEEcccccccccccccHHHHHHHHTccEEEEccccccTTTTTHHHHHHHTTTcEEEEcT:Sec Str : XXXXXXXXX :SEG|80->88|niiiknkik :###################### :PROS|44->82|PS00903|CYT_DCMP_DEAMINASES|PDOC00702| :============================================================:RP:SCP|1->140|1wwrA1|7e-21|26.5|132/151|c.97.1.2 :============================================================:BL:SWS|1->311|RIBD_BACSU|4e-38|32.5|308/361 :$$$$$$$$$ :RP:PFM|1->69|PF00383|2e-06|43.3|67/100|dCMP_cyt_deam_1 121: . . + . . .: 180 :LKKQINKFYAPYFFNRKKNLPYVTGKIAISKNNLIYSKDTKRISDIHTDRFTHFLRYKND:Sequence :THHHHHHHTHHHHHHHHHcccEEEEEEEEETTcccTTcccTTcccHHHHHHHTTHHHHcc:Sec Str :==================== :RP:SCP|1->140|1wwrA1|7e-21|26.5|132/151|c.97.1.2 : ========================================:RP:SCP|141->313|2b3zA1|4e-29|27.6|170/214|c.71.1.2 :============================================================:BL:SWS|1->311|RIBD_BACSU|4e-38|32.5|308/361 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|141->306|PF01872|2e-12|30.2|159/198|RibD_C 181: . * . . . .: 240 :SLMISSKTLNKDDPKLNCRLEGLSKFSPKRIILDRNLEIKKNSYIFKTANKDNTIIFYYN:Sequence :EEEEEHHHHHHHccccccccTTcccHccEEEEEcTTccccTTcHHHHcccccEEEEEcTT:Sec Str :============================================================:RP:SCP|141->313|2b3zA1|4e-29|27.6|170/214|c.71.1.2 :============================================================:BL:SWS|1->311|RIBD_BACSU|4e-38|32.5|308/361 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|141->306|PF01872|2e-12|30.2|159/198|RibD_C 241: + . . . . *: 300 :AKAEVKLMLKKKGITLIKSKLNKNSFDIKSILMKLYVLGCRNLLVEGGNDLSKHIIKKKL:Sequence :ccHHHHHHHHTTTcEEEEcccccccccHHHHHHHHHHTTccEEEEEEcHHHHHHHHHHTc:Sec Str :============================================================:RP:SCP|141->313|2b3zA1|4e-29|27.6|170/214|c.71.1.2 :============================================================:BL:SWS|1->311|RIBD_BACSU|4e-38|32.5|308/361 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|141->306|PF01872|2e-12|30.2|159/198|RibD_C 301: . . . . + .: 360 :FNEFYLYKCSKSLSKLVNHKEFGFLKELKKNYKNKLKINKKLGKDVITLYK :Sequence :ccEEEEEEEcccccEEEEEcccEc :Sec Str : XXXXXXXXXXXXXXXXXXXX :SEG|325->344|lkelkknyknklkinkklgk :============= :RP:SCP|141->313|2b3zA1|4e-29|27.6|170/214|c.71.1.2 :=========== :BL:SWS|1->311|RIBD_BACSU|4e-38|32.5|308/361 :$$$$$$ :RP:PFM|141->306|PF01872|2e-12|30.2|159/198|RibD_C