[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "pubi0:sucA"

sucA        "2-oxoglutarate dehydrogenase E1 component"
            ""

OrgPattern -------------------------------------------------------------------- 111111111111111-111-11111111111111111111111111111111111111--11111111111-----------1--------------1111111121111111111111111111---1----11-11111----1-------------------------------------11111---1-11111111111111111111111111111111-------111111111111111111111------------------------------------------------------------------------------------------------------------------------1-1111111111111111111111122222222222-11111111111211111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111211111122111111111121111112111111111111111---1111111111111111--------------11111111-111111-1---------------------------111111111111111111111111111111--1111111111121111111112122211-1111121111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111--1-111111----------------------------------------------111 11--222-522-222-111111132421111111111111111111211111221111111111111111111111111111113111-24212261112211324-3-26654446333333397333EY423593333633331332343363343337I23328F63F22532112U2221232631248144331 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSSSKNLEFEKTSFLSKSNSAFIEQMYLKFINKDKDLPESWQNYFEGMSEDLSMIAKEIN:Sequence : :Sec Str : ====================================================:BL:SWS|9->957|ODO1_BRUC2|0.0|54.7|947/1004 61: . . . * . .: 120 :GPSWNIKKKIDIDEVEKRIEEDEKKLSNEGNIAKVNSKDLVKSNINSIRAVALIRAYRQR:Sequence : HHHHHHHHHHHHHHHHHH:Sec Str : XXXXXXXXXXXXXXXXXXXX :SEG|66->85|ikkkididevekrieedekk :============================================================:BL:SWS|9->957|ODO1_BRUC2|0.0|54.7|947/1004 121: . . + . . .: 180 :GHLLAKLDPLGMMETEYLDELHPEHYGFKKENYDEKIYLDGVINKEHSSIKEILNFLNKT:Sequence :GGGGcccccccccccGGGccccccccccccccccTTccGGGcccccTTccccccTTccGG:Sec Str :============================================================:BL:SWS|9->957|ODO1_BRUC2|0.0|54.7|947/1004 181: . * . . . .: 240 :YCGPIGYEYMHISNPTERKWLRDRIEQDENSLQFTKNGKEAILMKLIQAEGFEKFLHKKY:Sequence :GGTTGGGcccccccTTcccccGGGcccGGGcccccHHHHHHHHHHHHHHHHHHHHHHHHH:Sec Str : ====================================================:RP:SCP|189->570|1ni4A|5e-45|20.7|348/362|c.36.1.11 :============================================================:BL:SWS|9->957|ODO1_BRUC2|0.0|54.7|947/1004 : $$$$$$$$$:RP:PFM|232->542|PF00676|4e-51|43.7|286/298|E1_dh 241: + . . . . *: 300 :VGTKRFGLDGGEGLIPALEQIIKIGGQAKVKEVKIGMSHRGRLNVLANVLQKSYKRIFNE:Sequence :HHHHTccccHHHHHHHHHHHTTccHHHHHHHHHHHHHHHTccccTTcTTcTTccEEEEcc:Sec Str :============================================================:RP:SCP|189->570|1ni4A|5e-45|20.7|348/362|c.36.1.11 :============================================================:BL:SWS|9->957|ODO1_BRUC2|0.0|54.7|947/1004 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|232->542|PF00676|4e-51|43.7|286/298|E1_dh 301: . . . . + .: 360 :FAGDIQTSGEEGAGDVKYHLGASSNREFDGNSVHVSLTDNPSHLEAVNPVVLGQTRAKQF:Sequence :GGHHHHHHHHHHTTHHTTTTcTTccccccccTTcTTcccccccTTHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|189->570|1ni4A|5e-45|20.7|348/362|c.36.1.11 :============================================================:BL:SWS|9->957|ODO1_BRUC2|0.0|54.7|947/1004 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|232->542|PF00676|4e-51|43.7|286/298|E1_dh 361: . . . * . .: 420 :FHKDKERNKVIPILIHGDAAFAGQGVVTECFAMSGLPGHNTGGTIHIIVNNQIGFTTSPR:Sequence :ccTTcccccccEEEEEcHHHHHcHHHHHHccHHHHHHHTTcTTEEEEEEEccEETTEEEG:Sec Str :============================================================:RP:SCP|189->570|1ni4A|5e-45|20.7|348/362|c.36.1.11 :============================================================:BL:SWS|9->957|ODO1_BRUC2|0.0|54.7|947/1004 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|232->542|PF00676|4e-51|43.7|286/298|E1_dh 421: . . + . . .: 480 :FARSSPYPSDVAKMVDAPILHVNGDDPEAVVYATRIATEFRLKFNRDVVVDLICYRRFGH:Sequence :GGTccccHHHHHHHHTcEEEEEccTTTcHHHHHHHHHHHTTHcTTccEEEEEEccTTTTc:Sec Str :============================================================:RP:SCP|189->570|1ni4A|5e-45|20.7|348/362|c.36.1.11 :============================================================:BL:SWS|9->957|ODO1_BRUC2|0.0|54.7|947/1004 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|232->542|PF00676|4e-51|43.7|286/298|E1_dh 481: . * . . . .: 540 :NEGDEPSFTQPLMYKKIRSHPTPVEMYGKKLVNENTLSESELSKFKTDFKNLLDDQYKNA:Sequence :TTTTcGGGTcccccccHHHHHHHHHHTTccTTccccccHHHHHHHHHHTHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|189->570|1ni4A|5e-45|20.7|348/362|c.36.1.11 :============================================================:BL:SWS|9->957|ODO1_BRUC2|0.0|54.7|947/1004 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|232->542|PF00676|4e-51|43.7|286/298|E1_dh 541: + . . . . *: 600 :KDYKPKIEWYEGTWSRYKPEKGKDKRGVSGYDQQKLLEISEKINATPEKLKLHKTIVKIL:Sequence :HHHHHHHHHHHccHHHHHHHcHHHHHHHHHHTTTcccTTGGGGcccccTTcccEEHHHHH:Sec Str :============================== :RP:SCP|189->570|1ni4A|5e-45|20.7|348/362|c.36.1.11 :============================================================:BL:SWS|9->957|ODO1_BRUC2|0.0|54.7|947/1004 :$$ :RP:PFM|232->542|PF00676|4e-51|43.7|286/298|E1_dh 601: . . . . + .: 660 :DARKASVSNGKGIDWSTAEALAFGSLLEEGYPVRLVGQDSGRGTFSQRHSVLRNQEDNSR:Sequence :HHHHHHHTTTcTTEEEEEcccHHHHTcccTTccEEccGGGccEETTccETTHHHHHcTTT:Sec Str : ===================================================:RP:SCP|610->814|1dtwB1|1e-49|22.8|184/188|c.36.1.7 :============================================================:BL:SWS|9->957|ODO1_BRUC2|0.0|54.7|947/1004 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|613->805|PF02779|6e-23|40.5|168/172|Transket_pyr 661: . . . * . .: 720 :YIPLNNISKNQMRYEIVDSFLSELAVLGFEYGYSLVEPNTLTIWEAQFGDFANGAQVVID:Sequence :ccTTccccTTcTTccEEEccccHHHHHHHHHHHHHHcTEEEETcEEEEEEEHHHHGGGHH:Sec Str :============================================================:RP:SCP|610->814|1dtwB1|1e-49|22.8|184/188|c.36.1.7 :============================================================:BL:SWS|9->957|ODO1_BRUC2|0.0|54.7|947/1004 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|613->805|PF02779|6e-23|40.5|168/172|Transket_pyr 721: . . + . . .: 780 :QFIASGERKWTRASGLVMLLPHGYEGQGPEHSSARLERFLQLCANDNLQVLNCTTPANYY:Sequence :HHHHHHHHTcEccEEEEEcccGGGcTTcTTcccccHHHHHHHTcccccEEEccccHHHHH:Sec Str :============================================================:RP:SCP|610->814|1dtwB1|1e-49|22.8|184/188|c.36.1.7 :============================================================:BL:SWS|9->957|ODO1_BRUC2|0.0|54.7|947/1004 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|613->805|PF02779|6e-23|40.5|168/172|Transket_pyr 781: . * . . . .: 840 :HALRRQMHREFRKPLIIMTPKSLLRNKHCVSNIEDFGKDNFFHRILWDHALDEENGFIKL:Sequence :HHHHHHHHHcccccEEEEccccEEcccTTccHHHHTGGGGGccEEEEcccccTccEEEEc:Sec Str :================================== :RP:SCP|610->814|1dtwB1|1e-49|22.8|184/188|c.36.1.7 : =:RP:SCP|840->967|1dtwB2|8e-12|14.3|119/138|c.48.1.2 :============================================================:BL:SWS|9->957|ODO1_BRUC2|0.0|54.7|947/1004 :$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|613->805|PF02779|6e-23|40.5|168/172|Transket_pyr : $$$$$$$$$:RP:PFM|832->944|PF05342|5e-04|32.0|97/250|Peptidase_M26_N 841: + . . . . *: 900 :KESSKIKKVILCSGKVYFDLLEAREKLKKDDVVLYRIEQLYPFPVKSLVREIKKYAKNAN:Sequence :cccccEcEEEEEcTTHHHHHHHHHHHHHHTcEEEEEcccHHHHHTccHHHHHHHcccTTc:Sec Str :============================================================:RP:SCP|840->967|1dtwB2|8e-12|14.3|119/138|c.48.1.2 :============================================================:BL:SWS|9->957|ODO1_BRUC2|0.0|54.7|947/1004 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|832->944|PF05342|5e-04|32.0|97/250|Peptidase_M26_N 901: . . . . + .: 960 :FYWCQEEPKNMGAWFSVRDYIQWTLETINANNTGISYIGRSPDASPATGYAKRHLAQQQE:Sequence :cEEEEcccccGGGGGTccEEEcccccccccHHHHHHHHTccHcHHHHHHHHHHHHHHTTc:Sec Str :============================================================:RP:SCP|840->967|1dtwB2|8e-12|14.3|119/138|c.48.1.2 :========================================================= :BL:SWS|9->957|ODO1_BRUC2|0.0|54.7|947/1004 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|832->944|PF05342|5e-04|32.0|97/250|Peptidase_M26_N 961: . . . * . .:1020 :IIKKVFE :Sequence :ccccTTc :Sec Str :======= :RP:SCP|840->967|1dtwB2|8e-12|14.3|119/138|c.48.1.2