[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "pubi0:uvrC"

uvrC        "excinuclease ABC chain C"
UVRC_PELUB  "RecName: Full=UvrABC system protein C;         Short=Protein uvrC;AltName: Full=Excinuclease ABC subunit C;"

OrgPattern ------------------------11111111111---1111111111-1111-------------11 1121111111111111111-11111111111111111111211112121111111111111121111111211111111111111111111111112--1111111112111111111111111111111111121111111111211111111111111111111211111111111111111111111111111111111111111111111111111111112222221111111111111111111111211111111111111111111111111111111111111111111111111111111111111111111111222222222212111221111211111111122111111111111111212111111111111111111111111111111111-111111111111111111111111111111111111-111111111111111111111---------1122111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--11111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--11111111111111111111111111-111111111111111111111111111111111111111111111111111111211111111111111111-1111111111111111111111-1-11111111111111111111111111111111 ------------------------------------------------------------------------------------------------------------2-------------------------------------------------------------3--1-1-----1---1--1-----1---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKSSELGKDVIRKELPLIPKSPGVYRMLDHKDVILYVGKAKNLPNRLKSYVAEKNHIIRT:Sequence : cHHHHHHHHTcccccccEEEEcTTccEEEEEEEEccccccEEccccccccccc:Sec Str : =========================:RP:SCP|36->179|1bqqT|6e-13|10.8|130/184|b.40.3.1 :============================================================:BL:SWS|1->611|UVRC_PELUB|0.0|100.0|611/611 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|22->52|PF01541|3e-04|45.2|31/80|GIY-YIG 61: . . . * . .: 120 :ARMLSQTFKLEITTTANESEALLLEANLIKKHKPKFNILLKDDKSFPFVFISNKDQWAQV:Sequence :ccEEEEcccEccEEEEccccccccEEEcccTTTTccccccccccEE EEEEEEcccccE:Sec Str : XXXXXXXXXXXXXXXX :SEG|73->88|tttaneseallleanl :============================================================:RP:SCP|36->179|1bqqT|6e-13|10.8|130/184|b.40.3.1 :============================================================:BL:SWS|1->611|UVRC_PELUB|0.0|100.0|611/611 121: . . + . . .: 180 :TKHRGKKDKEGFYFGPFASAGTANWTIKMLQKIFQIRVCDDSTFKNRKRPCILYQIKRCS:Sequence :EccTTc cEEEGGGccHH HHTTTTTHHH HGGGcccccccccccccccTTccH:Sec Str :=========================================================== :RP:SCP|36->179|1bqqT|6e-13|10.8|130/184|b.40.3.1 :============================================================:BL:SWS|1->611|UVRC_PELUB|0.0|100.0|611/611 : $$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|155->333|PF01496|1e-04|26.0|173/631|V_ATPase_I 181: . * . . . .: 240 :GPCVDYIDKEDYKKSVDQAIQFVSGKSRDIQKNLSKQMEEASEKLDFERASIFRDRIKSL:Sequence :HHHHHHHH ccTTccccccccHHHHHHHHHHHHHHHHHTEcGGGcEEEcccHHHH:Sec Str : =============================:RP:SCP|212->305|1oeyJ|2e-16|6.7|90/105|d.15.2.2 :============================================================:BL:SWS|1->611|UVRC_PELUB|0.0|100.0|611/611 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|155->333|PF01496|1e-04|26.0|173/631|V_ATPase_I 241: + . . . . *: 300 :NIIQSSQRINEANLIDADVIAAYKESGKTCIQVFFYRSKQNWGNQAYFPKHDPDQSLSEI:Sequence :HHHHHHHcccccccccccEEEHHHHHHHHHHHHHHHTTccTTcEEEEEEc ccccHHH:Sec Str :============================================================:RP:SCP|212->305|1oeyJ|2e-16|6.7|90/105|d.15.2.2 :============================================================:BL:SWS|1->611|UVRC_PELUB|0.0|100.0|611/611 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|155->333|PF01496|1e-04|26.0|173/631|V_ATPase_I 301: . . . . + .: 360 :MSSFLMQFYENKNVPKLIIINTEIEDKKLIEETLSKKENSAISINVAKKGTKAKVIAMAE:Sequence :HHHHHHHHHHHcccEEEEEEccccHH HHHHHHHHHHTTccEEEEEGGccTTTHHHHH:Sec Str :===== :RP:SCP|212->305|1oeyJ|2e-16|6.7|90/105|d.15.2.2 :============================================================:BL:SWS|1->611|UVRC_PELUB|0.0|100.0|611/611 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|155->333|PF01496|1e-04|26.0|173/631|V_ATPase_I 361: . . . * . .: 420 :KNAKESLNRKIYETNNNKNLFEGVAKKFDLKNGLNLVEVYDNSHISGTNSVGAMITFGNE:Sequence :HHHHHHHHHHTTccccEEcccHHHHHHHcTTccccEEEEEEEEEccccEEEEEEEEEcTT:Sec Str : =:RP:SCP|420->538|1xkpB1|3e-22|13.1|107/121|d.198.1.1 :============================================================:BL:SWS|1->611|UVRC_PELUB|0.0|100.0|611/611 : $$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|397->543|PF08459|3e-36|54.7|139/156|UvrC_HhH_N 421: . . + . . .: 480 :GFVKKRYRKFDIKTKGNEQDDFAMLKEVLTRRFKRAMLEKGNYLTLPDLILIDGGKGQYS:Sequence :ccEEEEEEcccEEGGcGHHHHHHHHHHHHHHHHHHHHHHTcTcTTccccEEEEEEEcccc:Sec Str :============================================================:RP:SCP|420->538|1xkpB1|3e-22|13.1|107/121|d.198.1.1 :============================================================:BL:SWS|1->611|UVRC_PELUB|0.0|100.0|611/611 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|397->543|PF08459|3e-36|54.7|139/156|UvrC_HhH_N 481: . * . . . .: 540 :SAKEVLDEFGLHDLPMIAIAKGKLRNSGDETFFYKGKSFKFDKNDPTLFFMQRLRDEAHR:Sequence :ccHHHHHHHHHHHHHHHHHTTcccTTcEEEEEEEEEcccEEccccEEEccccEEEEEEEc:Sec Str :========================================================== :RP:SCP|420->538|1xkpB1|3e-22|13.1|107/121|d.198.1.1 : =============:RP:SCP|528->611|2oceA1|1e-14|18.3|82/90|a.60.2.6 :============================================================:BL:SWS|1->611|UVRC_PELUB|0.0|100.0|611/611 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|397->543|PF08459|3e-36|54.7|139/156|UvrC_HhH_N 541: + . . . . *: 600 :FAITSHRAKRAKGITKSLLDQIDGIGSIRKRALLNHFGSARAVESASFDEIKSVEGVEEK:Sequence :cccEEEEEEEEEEEEEcccTTTHHHHHHHHHHHHHHHTTccTTHccccccccHHHHHHHH:Sec Str :============================================================:RP:SCP|528->611|2oceA1|1e-14|18.3|82/90|a.60.2.6 :============================================================:BL:SWS|1->611|UVRC_PELUB|0.0|100.0|611/611 :$$$ :RP:PFM|397->543|PF08459|3e-36|54.7|139/156|UvrC_HhH_N 601: . . . . + .: 660 :VAKKIYNFFHE :Sequence :HHHHHHHHHHT :Sec Str :=========== :RP:SCP|528->611|2oceA1|1e-14|18.3|82/90|a.60.2.6 :=========== :BL:SWS|1->611|UVRC_PELUB|0.0|100.0|611/611