[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "pubi0:wcaG"

wcaG        "GDP-fucose synthetase chain A"
            ""

OrgPattern ------------------------2---2-----------1---1---11-21-111----------- 121-------------1----1---111111--1-1-1111---1----11-1--1--------2----1----------------111112-211-----1-13211-1-----------------1-111111-111-------1211221111111-111121211111-1-111-2--1-1---------------------------------1------------11---------------------------------------------------------------------------------------------1-----------1-11------------1---11-1------------111-1-------1221-1----2---12--11111-22-22222-1---11-111222--1-1--1-11----1--------------211-----------------------------11-----11-------1-------11-------121--1-1---21----1111----1-1--------------2----11-3212-11112112112-21111--1111---221-5-111111111--1------1--11---1----------------------1--1------11---1-122111111--2112121111211111112--1-1---1111111111111111-11-11111-1-11111111-1----22322----1--------------------------------------1---------1----------------------1--------------1-12111122----------------------------------------------111 11--111-1-1---1------------------------------------1-------------------------------------141-111----11-111--124142241111--1111111381-1221---1111--111-1--111-111231111-112-111111-18111-14464-5A2121111 -----------------------1---------------------------------------------------------------------------------------------------------------------------------------------------1---

Master   AminoSeq   


1: . . . . + .: 60 :MINRNSRIFITGHKGLVGSAIYRKLKAKGYTNLLIADRKKLDLTNQIKVIKFLKKKKPDF:Sequence : ccccEEEEETTTcHHHHHHHHHHTTcTTEEEEcccTTTccTTcHHHHHHHHHHHcccE:Sec Str : XXXXXXXXXXXXXX:SEG|47->63|ikvikflkkkkpdfifi : ======================================================:RP:SCP|7->311|1bsvA|3e-30|43.4|302/317|c.2.1.2 :============================================================:BL:SWS|1->308|FCL2_ARATH|5e-74|45.1|306/328 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->222|PF01370|2e-15|32.0|200/232|Epimerase 61: . . . * . .: 120 :IFIAAAKVGGIYYNLKYKADFITENLQIQTNLIHGAYKCGIKDLIFLGSSCVYPKNCKQP:Sequence :EEEcccccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHTTccEEEEEccGGGccTTcccc:Sec Str :XXX :SEG|47->63|ikvikflkkkkpdfifi :============================================================:RP:SCP|7->311|1bsvA|3e-30|43.4|302/317|c.2.1.2 :============================================================:BL:SWS|1->308|FCL2_ARATH|5e-74|45.1|306/328 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->222|PF01370|2e-15|32.0|200/232|Epimerase 121: . . + . . .: 180 :IKETYLLSGKLEETNDAYAIAKIAGIKMCQSYNEQYKTKYKCLMPTNTYGPNDNYDKNNS:Sequence :ccGGGTTcccccGGGHHHHHHHHHHHHHHHHHHHHHccEEEEEEEcEEEcTTccccTTcc:Sec Str :============================================================:RP:SCP|7->311|1bsvA|3e-30|43.4|302/317|c.2.1.2 :============================================================:BL:SWS|1->308|FCL2_ARATH|5e-74|45.1|306/328 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->222|PF01370|2e-15|32.0|200/232|Epimerase 181: . * . . . .: 240 :HFIPALIKKIHKLKLSKKNTVILWGNGKAKREVIHVDDIAEACIFFMKKKTEHFLINIGT:Sequence :cHHHHHHHHHHHHHHHTccEEEEEcccccEEcEEEHHHHHHHHHHHHHccHHHHHHTccT:Sec Str : XXXXXXXXXXXXX :SEG|186->198|likkihklklskk :============================================================:RP:SCP|7->311|1bsvA|3e-30|43.4|302/317|c.2.1.2 :============================================================:BL:SWS|1->308|FCL2_ARATH|5e-74|45.1|306/328 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|8->222|PF01370|2e-15|32.0|200/232|Epimerase 241: + . . . . *: 300 :GKDYSIKYYLEFIAKVILGNKKIKIKYDKTKPNGSPRKVMDISLAKKYGWKSKMSLITSI:Sequence :TcccEEEcccccEEHHHHHHHHHHHHTcccEEEEETTcccccHHHHHTTccccccHHHHH:Sec Str : XXXXXXXXXXX :SEG|261->271|kkikikydktk :============================================================:RP:SCP|7->311|1bsvA|3e-30|43.4|302/317|c.2.1.2 :============================================================:BL:SWS|1->308|FCL2_ARATH|5e-74|45.1|306/328 301: . . . . + .: 360 :RNTYKSFVRENF :Sequence :HHHHHHHTHHTH :Sec Str :=========== :RP:SCP|7->311|1bsvA|3e-30|43.4|302/317|c.2.1.2 :======== :BL:SWS|1->308|FCL2_ARATH|5e-74|45.1|306/328