[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "pubi0:yaeM"

yaeM        "1-deoxy-D-xylulose 5-phosphate reductoisomerase"
DXR_PELUB   "RecName: Full=1-deoxy-D-xylulose 5-phosphate reductoisomerase;         Short=DXP reductoisomerase;         EC=1.1.1.267;AltName: Full=1-deoxyxylulose-5-phosphate reductoisomerase;AltName: Full=2-C-methyl-D-erythritol 4-phosphate synthase;"

OrgPattern -------------------------------------------------------------------- 111111111111-111111-1111111111111111111111112111111111111111111111111111111111111111111111111111---------1111111111111111111111111111111-----111-11111111111111111111111111111111111111111111111112222221221122211111112121111-11111111111-----------------------------------------------------------------------------------------11111111111111111111111111--111111111111111111111-1111111-----1111111111111------------11111111--1-11111111111111111111111111111111111111111111111111111---------------111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111--111111111111111111111111111111111111111111111111111111111111--11111--1111111111111-111111-111111111111111111111111111111111111111111111111111111111111111111111---------1111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111--------11------------1------1------1111111111111 11------1---------------------------------------------------------------------------------------------------1-----------------------------------------------------------------111119111112122-1211----1 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKKIAIFGSTGSIGSSLLKIIKDDQKNFKIELLTVNKNYKKLIKQVKLFNVKNVIVTDYN:Sequence :cEEEEEEEcccHHHHHHHHHHHHcTTTEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHc:Sec Str : ===========================================================:RP:SCP|2->149|1jvsA2|1e-24|27.4|146/152|c.2.1.3 :============================================================:BL:SWS|1->388|DXR_PELUB|0.0|100.0|388/388 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->128|PF02670|2e-13|34.7|124/128|DXP_reductoisom 61: . . . * . .: 120 :SFLITTKLLKNAKVKVFNNFDSLNKIFNTNNKIDYSMCAISGFDGLKPTLDIIKFTKTIA:Sequence :cEEccHccccEEEccccccccccHHHHTHHHHHHTGGccHHHHHHHHHHHHHHHTccHHH:Sec Str :============================================================:RP:SCP|2->149|1jvsA2|1e-24|27.4|146/152|c.2.1.3 :============================================================:BL:SWS|1->388|DXR_PELUB|0.0|100.0|388/388 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->128|PF02670|2e-13|34.7|124/128|DXP_reductoisom 121: . . + . . .: 180 :IANKESIICGWNLIKKDLKKYKTYFVPVDSEHFSIWSLLDNNKKNNFEKIYITASGGPFR:Sequence :HHHHHHHHccccEEEEEccccTTcEEcTHHHHHHHHHHTHHHHTTEEEEEEEEccccccc:Sec Str :============================= :RP:SCP|2->149|1jvsA2|1e-24|27.4|146/152|c.2.1.3 : =======================================================:RP:SCP|126->254|1jvsA3|2e-47|41.1|129/149|d.81.1.3 :============================================================:BL:SWS|1->388|DXR_PELUB|0.0|100.0|388/388 :$$$$$$$$ :RP:PFM|4->128|PF02670|2e-13|34.7|124/128|DXP_reductoisom : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|146->228|PF08436|1e-24|55.4|83/84|DXP_redisom_C 181: . * . . . .: 240 :NLSLKKFRNISVKDALKHPNWSMGKKITIDSATMMNKVFEIIEAKKIFNLNYKQLEILIH:Sequence :cccccTTccccccHHHHTcHHHHHHHHTcTTccEEEEcHHHHTTccccHHHHHHGGGGTT:Sec Str :============================================================:RP:SCP|126->254|1jvsA3|2e-47|41.1|129/149|d.81.1.3 :============================================================:BL:SWS|1->388|DXR_PELUB|0.0|100.0|388/388 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|146->228|PF08436|1e-24|55.4|83/84|DXP_redisom_C 241: + . . . . *: 300 :PKSYLHAIVKFNNGLSKLLVHDTNMTIPIFNSIYFNTDKKLKSKNIDIKTLNNLNLKKID:Sequence :cHHHHHHHHHHHHcccccEEHHccTHHHHHHHHHTTcccTTccccccccccccccccccc:Sec Str : XXXXXXXXXXXXXXXXX:SEG|284->302|knidiktlnnlnlkkidni :============== :RP:SCP|126->254|1jvsA3|2e-47|41.1|129/149|d.81.1.3 :============================================================:BL:SWS|1->388|DXR_PELUB|0.0|100.0|388/388 301: . . . . + .: 360 :NIRFPVIKILNNLSNEDSLFETIIVSANDKLVKLFLNNKIKFNDISNTLIKICNTPEFNK:Sequence :TTTcTHHHHHHHHHHHcTTHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHTcGGGG:Sec Str :XX :SEG|284->302|knidiktlnnlnlkkidni : ==========================================================:RP:SCP|303->372|1jvsA1|3e-07|23.1|65/99|a.69.3.1 :============================================================:BL:SWS|1->388|DXR_PELUB|0.0|100.0|388/388 361: . . . * . .: 420 :FKSMKPRNIDEIQNLNDYVSLKISSMSV :Sequence :cccccHHHHHHHHcccTT :Sec Str :============ :RP:SCP|303->372|1jvsA1|3e-07|23.1|65/99|a.69.3.1 :============================ :BL:SWS|1->388|DXR_PELUB|0.0|100.0|388/388