[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "pubi0:ycaD"

ycaD        "transporter"
            ""

OrgPattern -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------1-1----1--11111------1---111111----------------------------------------------------------------------------------------------------------------------------------------------------1-1--1-----1-------22332333333------1--141-23332141125522-113211111234111111111------1-----------------------------1---2-11111--------------1-----------------------------1-----------------------1------------------------------111-111111----------1-----21--1-211-2122221112222121-211---11-1------1-1--22--------1-----1---1----------1------1111111111111111112---1111--111111111111----11-11------1211--1---------------------1-22222121232231111111111111----1111111--11--11111111--------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNKVLKNSWALFLGIGFLMMAYGFQGSLLGVRAVQEQFSLTATGFMMSGYFVGYFIGAMT:Sequence : =========================:RP:SCP|36->150,209->413|1pv6A|9e-05|12.5|309/417|f.38.1.2 : =================================================:BL:SWS|12->369|YFKF_BACSU|7e-20|24.9|341/391 : $$$$$$$$$$$$$$$$$:RP:PFM|44->149|PF05977|2e-05|25.0|104/402|DUF894 61: . . . * . .: 120 :ISNLISKVGHIRVFAAFASLASLVILVHSIFINPYVWFILRVLTGISMVCIYTVAESWLN:Sequence :============================================================:RP:SCP|36->150,209->413|1pv6A|9e-05|12.5|309/417|f.38.1.2 :============================================================:BL:SWS|12->369|YFKF_BACSU|7e-20|24.9|341/391 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|44->149|PF05977|2e-05|25.0|104/402|DUF894 121: . . + . . .: 180 :DRSSNKNRGSILSIYMVILYGSMGIGMFLLNFSRPENYQPFILVSIITSLALIPILLTKK:Sequence : XXXXXXXXX:SEG|172->188|lipilltkkkpptfkki :============================== :RP:SCP|36->150,209->413|1pv6A|9e-05|12.5|309/417|f.38.1.2 :============================================================:BL:SWS|12->369|YFKF_BACSU|7e-20|24.9|341/391 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|44->149|PF05977|2e-05|25.0|104/402|DUF894 181: . * . . . .: 240 :KPPTFKKIQGMPLKELYETSPFGMVSALFYGTIQSALFTLLAVYAASMNFTIFQISLVTF:Sequence :XXXXXXXX :SEG|172->188|lipilltkkkpptfkki : ================================:RP:SCP|36->150,209->413|1pv6A|9e-05|12.5|309/417|f.38.1.2 :============================================================:BL:SWS|12->369|YFKF_BACSU|7e-20|24.9|341/391 241: + . . . . *: 300 :LLAISGAISQYPIGKLSDKYDRRKVIIISTFGASLFALLAILSSGQMYLPGELATSKVWF:Sequence : XXXXXXXXXXXX :SEG|273->284|aslfallailss : X:SEG|300->312|ffiflilfsicsl :============================================================:RP:SCP|36->150,209->413|1pv6A|9e-05|12.5|309/417|f.38.1.2 :============================================================:BL:SWS|12->369|YFKF_BACSU|7e-20|24.9|341/391 301: . . . . + .: 360 :FIFLILFSICSLPMFSLICAHTNDYIPKEKFVAAGAGIQFTFGLGAMSGPFLCSIFMNIV:Sequence :XXXXXXXXXXXX :SEG|300->312|ffiflilfsicsl :============================================================:RP:SCP|36->150,209->413|1pv6A|9e-05|12.5|309/417|f.38.1.2 :============================================================:BL:SWS|12->369|YFKF_BACSU|7e-20|24.9|341/391 361: . . . * . .: 420 :GSNGFFVFLLFFHALIGVFGIYRMRVRETVENPDSQFVAMPSTITPAGIELNPTTEHIDE:Sequence :===================================================== :RP:SCP|36->150,209->413|1pv6A|9e-05|12.5|309/417|f.38.1.2 :========= :BL:SWS|12->369|YFKF_BACSU|7e-20|24.9|341/391 421: . . + . . .: 480 :PYSDKVKEILDRKGVEYKKN :Sequence