[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "pubi0:yhdH"

yhdH        "zinc-binding alcohol dehydrogenase"
            ""

OrgPattern -------122222232--------------1-------------------11---------122---- -1-13112222-1-1------2--16-----1122222422-111-1--21121111---12--312221-----------1-1---1-------------1-1-7-111--------------------1---1122211---2-2-2211------------1-11112------------211-----11366666556-4654451111-1444122225532232313-23222232233222411233-2-22----13211214-2-1-111111---1---1111-1-1111-1--1-------------------21-1-----------1--------------------------------11-41--------211111-122231------------23122422232-4333323563222211-134425423311111111134--2-1-----------------------------21-1-1151211221221----1124-----11-42532-122113111314321-13--1------------1223--1-1----------211111-12122223--1--------------------------21221121512-1111111-1111-11222--11212------22131111113122211-111111211112111111111222112111111111111111121111111--122222222222---111-112222-1123-----------------112-12212-1111-32211-221412----------2112111112121123--1-----1111--1-22--11----------------------------------------------11- --2111--2---11-234124736272212-221212222121---63577AEF-132131322322--1133-122221--1-2-23-283332432214-3261-121-233--11----222222-6A2-3321---3-252-22122113-1213353-22------2232-1--7--1-45464323--64361 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSDNFKALVVNQESENFTREVKSIDKSFLKHGDVLVQVDYSDLNYKDALILNNGAKLVKE:Sequence :HccEEEEEEEccccccHHHHEEEEEcccccTTEEEEEEEEEEccTTHHHHHTTTTcTTcc:Sec Str : =======================================================:RP:SCP|6->135|1a71A1|5e-13|22.3|121/198|b.35.1.2 : =======================================================:BL:SWS|6->332|YHDH_ECOLI|1e-61|37.8|323/324 61: . . . * . .: 120 :FPHIPGIDFAGTVLESDNSKFIKGDEVILTGWRVGEIYFGGYSQFAKVNGDYLVKKPKDI:Sequence :ccEEcccEEEEEEEEETGGGTccTTcEEEcEEEEEEEcccccccEEEEEGGGcEEccccc:Sec Str :============================================================:RP:SCP|6->135|1a71A1|5e-13|22.3|121/198|b.35.1.2 : =:RP:SCP|120->295|1o89A2|5e-31|43.0|172/177|c.2.1.1 :============================================================:BL:SWS|6->332|YHDH_ECOLI|1e-61|37.8|323/324 121: . . + . . .: 180 :SSKQAMILGTAGLTALLCSFAIKAREELLLGEKVKDVLVTGASGGVGSIAVMILNKFGYD:Sequence :HHHHTTTTHHHHHHHHHHHHTHHTTTcccTTcEETccEETTTTcTTHHHHHHHHHHTTcE:Sec Str :=============== :RP:SCP|6->135|1a71A1|5e-13|22.3|121/198|b.35.1.2 :============================================================:RP:SCP|120->295|1o89A2|5e-31|43.0|172/177|c.2.1.1 :============================================================:BL:SWS|6->332|YHDH_ECOLI|1e-61|37.8|323/324 : $$$$$$$$$$$$$$$$:RP:PFM|165->272|PF00107|3e-05|32.4|108/128|ADH_zinc_N 181: . * . . . .: 240 :VTAVTGKAENEKYLRSLGAKNIINKADLDKDARPLDKGLWDGVVDTVGGKILANALAQTR:Sequence :EEEEEccHHHHHHHHHTTccEEEETccHHHHHHHHcTTcEEEEEEcccTHHHHHHHHHEE:Sec Str :============================================================:RP:SCP|120->295|1o89A2|5e-31|43.0|172/177|c.2.1.1 :============================================================:BL:SWS|6->332|YHDH_ECOLI|1e-61|37.8|323/324 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|165->272|PF00107|3e-05|32.4|108/128|ADH_zinc_N 241: + . . . . *: 300 :DNGIVAACGNASDYKLNTTVMPFIIRGVKLWGINSVTASIKRREFVWNEVKSLIDFEQLE:Sequence :EEEEEEEcccGGGTTcccccccccEEEccGGGcGGGHHHHHHHHHHTTcccccEEccTTc:Sec Str :======================================================= :RP:SCP|120->295|1o89A2|5e-31|43.0|172/177|c.2.1.1 :============================================================:BL:SWS|6->332|YHDH_ECOLI|1e-61|37.8|323/324 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|165->272|PF00107|3e-05|32.4|108/128|ADH_zinc_N 301: . . . . + .: 360 :KSIKTVSLEDLIDIYPKMLKGETSGRYIVDLNK :Sequence :TTcccccTTHHHHHHHHHHTTccccEEEEEcTc :Sec Str :================================ :BL:SWS|6->332|YHDH_ECOLI|1e-61|37.8|323/324