[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rcon0:AAL03054.1"

            "unknown"
            ""

OrgPattern -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-111---11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKLFLVQAKILSNSNIAKDKLTVTKELQKSIQQKEVSNERLTQEEIDNIYKTLGIFEEIK:Sequence : ===================================:BL:SWS|26->83|MACF1_MOUSE|6e-04|37.9|58/100 61: . . . * . .: 120 :EYEKSDNSRVPRLLNKNYYKLTDPREERRSDNIALEQDDTGMLTTDTDLEWDDTGILPPA:Sequence : XXXXXXXXXXXXXXXXX :SEG|98->114|ddtgmlttdtdlewddt :======================= :BL:SWS|26->83|MACF1_MOUSE|6e-04|37.9|58/100 121: . . + . . .: 180 :QNSAVSDKLKEAVDDYISELQNEKLSKDTSPKQVEAITHPMQEAIPTPLALS :Sequence