[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rcon0:AAL03106.1"

            "probable RND efflux transporter-like protein"
            ""

OrgPattern -------------------------------------------------------------------- 45C---------------------------------------------------------------------------------1-315654-611---125-4-63412--------------1111-1-11221----------2233432112212112134242461-1-----1-----1-----11------------------------------1--------2--------------------------------------------------------------------------------------------41-2-------1-1-122---------1--31--22211--1-----2-4317111-----458667564665422232333225-55746867455-5555334223339711-1-12122-112222222224343623---------1--1122-221112211-1----113575554566644222155894444345377898-246325413766355256363333-------33216431--1-12254222-23-123434324265241----11111-11-111111-1--144344342223323122233653335358465--13216------44322443333333433-3443333334333333333445322232222222222222222332-2233--333333332333--1134333343332421---111-1111-1114444435---736676757766865323311111111131443222223524457555554443333--1-3333221--1-111--------------------------------------164 --------------------------------------------------------------------------------------------------------------------------------------------------------------3----1-1-------1--------------4-----3---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MDYYAETIMAERLSMLPGVAQIQVYGSQQYAVRVQIDPVKMAVNNIGLDQVSNIISSANV:Sequence :HHHHHHHTTHHHHHccccccEEEEccccccccEEEEcHHHHHTTTccHHHHHHHHTTTcc:Sec Str : =========================================================:RP:SCP|4->98|1zruA3|5e-15|11.1|90/129|b.163.1.2 : =========================================================:BL:SWS|4->167|MDTC_YERPY|2e-25|35.0|163/1024 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->169|PF00873|5e-25|28.5|165/1014|ACR_tran 61: . . . * . .: 120 :NLPTGALYGTDIYSSIRAPGQLQNVKEYNELILTYKNGNPLFLKNIGKTIDSVANNKIAA:Sequence :cccccccccccccTccccccccccHHHHccEEEccTTTccEEHHHHEEEEccccccccEE:Sec Str :====================================== :RP:SCP|4->98|1zruA3|5e-15|11.1|90/129|b.163.1.2 : ==============================================:RP:SCP|75->169|1iwgA2|2e-11|13.8|94/104|d.58.44.1 :============================================================:BL:SWS|4->167|MDTC_YERPY|2e-25|35.0|163/1024 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->169|PF00873|5e-25|28.5|165/1014|ACR_tran 121: . . + . . .: 180 :WYRDKPGVILAIQKQPDTTNTIEIVDSIKEVLPLLRRQIPEGININIMF :Sequence :EETTEEcccEEEEHccccccHHHHHHHHHHHHTTTcccccccEEEEccc :Sec Str :================================================= :RP:SCP|75->169|1iwgA2|2e-11|13.8|94/104|d.58.44.1 :=============================================== :BL:SWS|4->167|MDTC_YERPY|2e-25|35.0|163/1024 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|4->169|PF00873|5e-25|28.5|165/1014|ACR_tran