[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAL03106.1 rcon0 AAL03106.1 "probable RND efflux transporter-like protein"
MDYYAETIMAERLSMLPGVAQIQVYGSQQYAVRVQIDPVKMAVNNIGLDQVSNIISSANV
NLPTGALYGTDIYSSIRAPGQLQNVKEYNELILTYKNGNPLFLKNIGKTIDSVANNKIAA
WYRDKPGVILAIQKQPDTTNTIEIVDSIKEVLPLLRRQIPEGININIMF
//