[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rcon0:AAL03110.1"

            "unknown"
            ""

OrgPattern -------------------------------------------------------------------- 222---------------------------------------------------------------------------------1--11123-1-------31--4---1--------------3----2--11--------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------121122------1-2223-112121-------------------1--1--------------22------------11111111-333---2-------------111-11-------------112311-22555632323333463333137-32538-1342-212-622-2-223-11213111-11--12--1-1211-1-1--1111---1--34411-1--13-1-111111-1----------2---11111-2----1---------111------1-----1--------11----1-111-111---1---111-1-11-------2221-----------------------1---------------------2-----2121--------------------22212121112-22132222-----2111111111111---------------11--------------------------------------------------------------------2-1 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MPPLKQQRHEQETTLKILVGRIPENIVNGLIYRNKPIDYFPALPVLPKILPSELLEQRPD:Sequence :HHHHHHHHHHHHHHHHHHHTccccTTcccc cccccTTcccccccccccGGGHHHHcHH:Sec Str :============================================================:RP:SCP|1->125|1wp1A|9e-19|30.8|120/456|f.5.1.1 : =========================================================:BL:SWS|4->125|OPRJ_PSEAE|5e-12|38.5|117/479 : $$$$$$:RP:PFM|55->125|PF02321|7e-06|31.0|71/189|OEP 61: . . . * . .: 120 :IKAAEQNLLAADVNLKTIKATYFPQISLTGLLGFGSNKLNTLFTNSAETWQVDGNIAGPI:Sequence :HHHHHHHHHHHHHHHHHHHTTcccEEEEEEEEEEEEcccTTcccTTcEEEEEEEEEEccc:Sec Str :============================================================:RP:SCP|1->125|1wp1A|9e-19|30.8|120/456|f.5.1.1 :============================================================:BL:SWS|4->125|OPRJ_PSEAE|5e-12|38.5|117/479 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|55->125|PF02321|7e-06|31.0|71/189|OEP 121: . . + . . .: 180 :FDFGK :Sequence :cccT :Sec Str :===== :RP:SCP|1->125|1wp1A|9e-19|30.8|120/456|f.5.1.1 :===== :BL:SWS|4->125|OPRJ_PSEAE|5e-12|38.5|117/479 :$$$$$ :RP:PFM|55->125|PF02321|7e-06|31.0|71/189|OEP