[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rcon0:AAL03301.1"

            "unknown"
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MYISSSIISKVALSSPTSSLKLFASSSSDLALLYSLIFATTSSSSAYSLDALTNSSPIMP:Sequence : XXXXXXX :SEG|3->9|isssiis : XXXXXXXXXXXXXXXXXXXXXXX :SEG|14->36|ssptsslklfassssdlallysl 61: . . . * . .: 120 :EDSLLPKFSYLSKIFAKLSEKRMLFYCDLFMGEISTLLREATESCDEAISGYLTRLSRSQ:Sequence 121: . . + . . .: 180 :PMAARNDDLYQHQNGTLYKLFKCYQELSTDCSVYYSVIGRKSYVHNCCYSYLIILDYSTF:Sequence 181: . * . . . .: 240 :CTSSDAHYTTLWWVNYSIEILNTVHTEVRNGKPSALKFFRG :Sequence