[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rcon0:AAL03501.1"

            "unknown"
            ""

OrgPattern -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---1111--1--------------------------------------------------1-------------1---------------1---------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNQNAFTEYVKELLEPYGSVVVRVMFGGYGIYKGGVMIGIIKSNELYFKSDLSTYEYFQS:Sequence : HHGGGGccEEEE ETTEEEEEETTEE EEEETTEEEEEccHHHHHHHHH:Sec Str : =======================================================:RP:SCP|6->78|2od0A1|4e-18|26.0|73/103|d.198.5.2 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|12->75|PF04993|5e-12|42.2|64/96|TfoX_N 61: . . . * . .: 120 :FGSESFVYQSKGKLVTLKKSQAQFLRFPRSLQLQ :Sequence :TTccccEEEETTEEEEcc :Sec Str :================== :RP:SCP|6->78|2od0A1|4e-18|26.0|73/103|d.198.5.2 :$$$$$$$$$$$$$$$ :RP:PFM|12->75|PF04993|5e-12|42.2|64/96|TfoX_N