[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rcon0:AAL03640.1"

            "proline/betaine transporter-like protein"
            ""

OrgPattern -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------22-14----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTTQGFNWRLAVWIDAIIAVVRGYAKAHLRETPDFVDASARLLRKYEKANIDKKELKNDE:Sequence 61: . . . * . .: 120 :IFYQKPKRRQLYIFS :Sequence