[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAL03640.1 rcon0 AAL03640.1 "proline/betaine transporter-like protein"
MTTQGFNWRLAVWIDAIIAVVRGYAKAHLRETPDFVDASARLLRKYEKANIDKKELKNDE
IFYQKPKRRQLYIFS
//