[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rcon0:AAL03659.1"

            "unknown"
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MFILNIFKTNWHKILSESTTSDLSNKNITDEQAKDLAAALKANRSLTSLYLPWNNIGEAT:Sequence : HHTTccEEEcTTccccGGGHHHHHHHHHHcccccEEEccccccHHHH:Sec Str : =======================================:RP:SCP|22->76|1pgvA|2e-04|10.9|55/167|c.10.1.1 : =======================================:BL:SWS|22->76|LRC45_CHICK|9e-07|45.5|55/670 61: . . . * . .: 120 :FKIINEYLYRNKTITKKSRKEI :Sequence :HHHHHHHHTcT :Sec Str :================ :RP:SCP|22->76|1pgvA|2e-04|10.9|55/167|c.10.1.1 :================ :BL:SWS|22->76|LRC45_CHICK|9e-07|45.5|55/670