[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rcon0:AAL03799.1"

            "cell surface antigen-like protein"
            ""

OrgPattern -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-2-24--1--1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MVWIGYRRGRIIVQFTQNSLVRFQQDVISDIDFNGTAAQVTIADGKNVGGATGGNIDNKL:Sequence : :Sec Str : =========================================:BL:SWS|20->95,275->592|OMPA_RICCN|6e-13|33.5|347/2021 61: . . . * . .: 120 :GGGVNILNFVGNSTVIGNVGATNPVNILNVQGNNAGTINLAAGGNLAAVTSSGGVNGIVN:Sequence : :Sec Str : XXXXXXXXXXXX:SEG|109->132|vtssggvngivnvlgvgtlgpvtg :=================================== :BL:SWS|20->95,275->592|OMPA_RICCN|6e-13|33.5|347/2021 121: . . + . . .: 180 :VLGVGTLGPVTGIAALNLNGAGNVMIVGASSATTLTINNAGVVATAAGGFTSNAAVGAGQ:Sequence : :Sec Str :XXXXXXXXXXXX :SEG|109->132|vtssggvngivnvlgvgtlgpvtg : XXXXXXXXXX :SEG|160->169|agvvataagg 181: . * . . . .: 240 :LTTNTTGNVTVGTGTYTGNITGNATFGGAGTINTTVITGQTDFKGSAGTVNVNDIGTLAA:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXXXXXXXX :SEG|182->205|ttnttgnvtvgtgtytgnitgnat : XXXX:SEG|237->251|tlaavtssaatnsnl 241: + . . . . *: 300 :VTSSAATNSNLVFLGGGNVTGVINNIGAITVNAAGNKTVILQKSVSATSLTLGNNAVANL:Sequence : :Sec Str :XXXXXXXXXXX :SEG|237->251|tlaavtssaatnsnl : XXXXXXXXXXXXX :SEG|255->267|gggnvtgvinnig : ==========================:BL:SWS|20->95,275->592|OMPA_RICCN|6e-13|33.5|347/2021 301: . . . . + .: 360 :QDSLTKSGNVDFTNGGVLEFSGANPAGYLLNSQIKNGNTGTLNVYTTGTILTATDSSIGM:Sequence : TTTTcccHHHHccTTccTTcEEEccccTTccccccccEEEEEccccEEEEEE:Sec Str :============================================================:BL:SWS|20->95,275->592|OMPA_RICCN|6e-13|33.5|347/2021 361: . . . * . .: 420 :VNTINIGQGNAVAAFTIDVSNKALTLGSDINLNNTKSVFGLTTSKNQQVTFMNSVDGFAG:Sequence :EEETcccTTccEEEEEEc ccEEEEEEEEEEcccccE EEEEEEEEcccccccEEEET:Sec Str :============================================================:BL:SWS|20->95,275->592|OMPA_RICCN|6e-13|33.5|347/2021 421: . . + . . .: 480 :GGGSVNLSSTSSTIPNDNVLTLQGNLGNETLGTKANPLAVINVSGNVGVVGTNATLGTNG:Sequence :TEEEEccccccEEEEEEEEEEEEcccGGGcEE :Sec Str : XXXXXXXXXXXXXXXXXXXXX:SEG|460->480|vinvsgnvgvvgtnatlgtng :============================================================:BL:SWS|20->95,275->592|OMPA_RICCN|6e-13|33.5|347/2021 481: . * . . . .: 540 :LDMSNTAVLNIAAGGVFADASLTSAKIAKINIGEVNAGPAVYALDALNGDFPLDAPGVTF:Sequence : :Sec Str :============================================================:BL:SWS|20->95,275->592|OMPA_RICCN|6e-13|33.5|347/2021 541: + . . . . *: 600 :VNSASVLKLMTTVASGKNSTIELTGNIEPVVPNTGVVEINARNANTKLTIDGMANKYAIG:Sequence : :Sec Str :==================================================== :BL:SWS|20->95,275->592|OMPA_RICCN|6e-13|33.5|347/2021 601: . . . . + .: 660 :TKANPVSKVQLTGHGTLVITALNTPNIDVSVAKVAIGSQCGSNFFLHSFRFY :Sequence : :Sec Str