[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAL03799.1 rcon0 AAL03799.1 "cell surface antigen-like protein"
MVWIGYRRGRIIVQFTQNSLVRFQQDVISDIDFNGTAAQVTIADGKNVGGATGGNIDNKL
GGGVNILNFVGNSTVIGNVGATNPVNILNVQGNNAGTINLAAGGNLAAVTSSGGVNGIVN
VLGVGTLGPVTGIAALNLNGAGNVMIVGASSATTLTINNAGVVATAAGGFTSNAAVGAGQ
LTTNTTGNVTVGTGTYTGNITGNATFGGAGTINTTVITGQTDFKGSAGTVNVNDIGTLAA
VTSSAATNSNLVFLGGGNVTGVINNIGAITVNAAGNKTVILQKSVSATSLTLGNNAVANL
QDSLTKSGNVDFTNGGVLEFSGANPAGYLLNSQIKNGNTGTLNVYTTGTILTATDSSIGM
VNTINIGQGNAVAAFTIDVSNKALTLGSDINLNNTKSVFGLTTSKNQQVTFMNSVDGFAG
GGGSVNLSSTSSTIPNDNVLTLQGNLGNETLGTKANPLAVINVSGNVGVVGTNATLGTNG
LDMSNTAVLNIAAGGVFADASLTSAKIAKINIGEVNAGPAVYALDALNGDFPLDAPGVTF
VNSASVLKLMTTVASGKNSTIELTGNIEPVVPNTGVVEINARNANTKLTIDGMANKYAIG
TKANPVSKVQLTGHGTLVITALNTPNIDVSVAKVAIGSQCGSNFFLHSFRFY
//