[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rcon0:AAL03816.1"

            "DNA repair protein (RadC)-like protein"
            ""

OrgPattern ----------------------------------------------1--1111--------------- ----------------------------------------------------------------------------------1--1111-11----1--11111112-11--------------1111121111-2-----2221--111--111--------11111111-----------------1112-111111-12-11-1111111111112122111111111112111-111111111111-111111111-1-111--1111--1-1111111111-111111111111111111111111111111111111112111111111111111112111111211-11--222211111112111-223-1211111111111111111111111111111-11111111112--11111111111121-11221121111111111112111111111111111-111--11111---11-3143-111211--13-1111-1----2211------1121111-1212132522211114211111--1111111131421-1331111-1111111-12-2124----1-11------------------------111232111121111211311132232221211---21-2------11231114337446341-32426261453531142111213222221211111211111111123221---111121111232--11-1-11-----16111111112211-111111-11-----2112121122222221111---------12311322422121411424351111111--11--------------1---------------------------1-1-111111--1 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKQKIINKNINASWSSWIDYLKVNMGNMRLEQFRILFLNKKNILIADEVLSQGTIDQAAV:Sequence : HHHTTccccTTccEEEEEEEcTTccEEEEEEEEcccccGGGc:Sec Str :============================================================:BL:SWS|1->112|RADC_AGRT5|7e-31|52.7|112/280 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|19->116|PF04002|5e-23|45.9|98/123|DUF2466 61: . . . * . .: 120 :YPREIIKRALFNEASSLILVHHHPSGSPEPSKANIHMTNKIVEKCQTINIIVLNLICSYE:Sequence :cHHHHHHHHHHTTccEEEEEEEcTTccccccHHHHHHHHHHHHHHHHHTcEEEE :Sec Str :==================================================== :BL:SWS|1->112|RADC_AGRT5|7e-31|52.7|112/280 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|19->116|PF04002|5e-23|45.9|98/123|DUF2466 121: . . + . . .: 180 :YK :Sequence : :Sec Str