[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAL03816.1 rcon0 AAL03816.1 "DNA repair protein (RadC)-like protein"
MKQKIINKNINASWSSWIDYLKVNMGNMRLEQFRILFLNKKNILIADEVLSQGTIDQAAV
YPREIIKRALFNEASSLILVHHHPSGSPEPSKANIHMTNKIVEKCQTINIIVLNLICSYE
YK
//