[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rcon0:AAL03819.1"

            "unknown"
Y1281_RICCN  "RecName: Full=Putative adhesin RC1281;Flags: Precursor;"

OrgPattern -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2222222222222----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKKLLLIAAASTALLTSGLSFADCDMNSSVDSSTNSSMSSSVENQWYLKLNAGGVIFNKT:Sequence : XXXXXXXXXXXXXXXXXXX :SEG|4->22|llliaaastalltsglsfa : XXXXXXXXXXXXXXXXXX :SEG|25->42|dmnssvdsstnssmsssv : ==================:BL:SWS|43->249|Y1281_RICCN|2e-85|100.0|207/249 61: . . . * . .: 120 :KPKGADFKLNNIKSNIKSNTGFTGEIGAGYYIMDNLRTDLTIGTVASSHLKKSKTYPDGN:Sequence : XXXXXXXXXX :SEG|70->79|nniksniksn :============================================================:BL:SWS|43->249|Y1281_RICCN|2e-85|100.0|207/249 121: . . + . . .: 180 :SFSVKNKPTIVSVLLNGYVDFVDLSMFKVFAGAGVGAAFVKEKIHSKDIKGGVTDTFNGT:Sequence : XXXXXXXXXXXXXXXXX :SEG|147->163|fkvfagagvgaafvkek : XXXXXXX:SEG|174->187|tdtfngttknktnf :============================================================:BL:SWS|43->249|Y1281_RICCN|2e-85|100.0|207/249 181: . * . . . .: 240 :TKNKTNFAYQLSLGTSFEVAQGVKAELVYSWRDYGKTKNTTKTINGDKVKFGGTHYKGHN:Sequence :XXXXXXX :SEG|174->187|tdtfngttknktnf : XXXXXXXX :SEG|216->223|ktknttkt :============================================================:BL:SWS|43->249|Y1281_RICCN|2e-85|100.0|207/249 241: + . . . . *: 300 :LMAGLRFDM :Sequence :========= :BL:SWS|43->249|Y1281_RICCN|2e-85|100.0|207/249