[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rcon0:addA"

addA        "erythrocyte adducin alpha subunit"
Y493_RICPR  "RecName: Full=Putative aldolase class 2 protein RP493;"

OrgPattern ------1---------1-----------------1---11------------------1----1---- --1-1---------1---------11-----1------21-1-1--------------11-1-1---111------------------------------------------------------------------------------------------------1111------------------11--------------1---1--------------------------------------------------------------------------------11111111111-----------------------1----1111111-1--1---------------111-1---------1----1-3111-----1-345--11-13---------------3--2-3-22-2------111-13-121-1-----11111111111111---1---------11--1111-11111-111-11-1151-222233444432222233663333235154354-1332-11--2-5153111-----------------2-----------------------------1---------------------------------2--1-31-------1-------------------------------------------------------------1332--1--1-111-1111111111------------------------------------1-14-------1111----11-11-2---2-1111-2341352-1111-11111111----------------------------------------------------------------------------1----1------ ----11---------4432422354333322232122222222222321114A3112--111121-12-1--3-1-----122232-----1412---1-211111--4154644743131333A8382JRA-866333161242132334239232341311112162255732---1-111-1---13---1----3 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MDIKYNLAAAYRIMAYLSLDDHTYTHLSARPKNAVFYYIYPFGLRFEEVTTENLLKVSLD:Sequence : HHHHHHHHHHHHHHHTTcccTTccEEEEEETTETEEEEccccccGGGccGGGcEEEcTT:Sec Str : ======================================================:RP:SCP|7->202|1dzuP|1e-41|20.5|190/209|c.74.1.1 :============================================================:BL:SWS|1->231|Y493_RICPR|e-126|90.9|231/231 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->184|PF00596|2e-21|35.6|177/181|Aldolase_II 61: . . . * . .: 120 :GQILEGEEYQYNKTGYFIHGSIYKTRPDISAIFHYHTPAAIAVSALKCGLLPISQWALHF:Sequence :ccccTTccccTccTTHHHHHHHHHHcTTccEEEEEccHHHHHHHHHTcccccccGGGGGG:Sec Str :============================================================:RP:SCP|7->202|1dzuP|1e-41|20.5|190/209|c.74.1.1 :============================================================:BL:SWS|1->231|Y493_RICPR|e-126|90.9|231/231 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->184|PF00596|2e-21|35.6|177/181|Aldolase_II 121: . . + . . .: 180 :YDRISYHNYNSLVLDADKQSSRLVTDLKQNYVMLLRNHGAITCGKTIHEAMFYTYHLEQA:Sequence :TcccccEEccccTTcHHHHHHHHHHHTccccEEEETTTEEEEEEccHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|7->202|1dzuP|1e-41|20.5|190/209|c.74.1.1 :============================================================:BL:SWS|1->231|Y493_RICPR|e-126|90.9|231/231 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->184|PF00596|2e-21|35.6|177/181|Aldolase_II 181: . * . . . .: 240 :CKTQCLLNSTKEQELIIPSVEICKQTVKDLLSFEEDLGKRDWAAWLRLVKM :Sequence :HHHHHHHHTTccccccccHHHH HHHTTcccTHHHHHHHHHHHHHH :Sec Str :====================== :RP:SCP|7->202|1dzuP|1e-41|20.5|190/209|c.74.1.1 :=================================================== :BL:SWS|1->231|Y493_RICPR|e-126|90.9|231/231 :$$$$ :RP:PFM|7->184|PF00596|2e-21|35.6|177/181|Aldolase_II