[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAL03216.1 rcon0 addA "erythrocyte adducin alpha subunit"
MDIKYNLAAAYRIMAYLSLDDHTYTHLSARPKNAVFYYIYPFGLRFEEVTTENLLKVSLD
GQILEGEEYQYNKTGYFIHGSIYKTRPDISAIFHYHTPAAIAVSALKCGLLPISQWALHF
YDRISYHNYNSLVLDADKQSSRLVTDLKQNYVMLLRNHGAITCGKTIHEAMFYTYHLEQA
CKTQCLLNSTKEQELIIPSVEICKQTVKDLLSFEEDLGKRDWAAWLRLVKM
//