[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rcon0:cyaY"

cyaY        "cyaY protein"
CYAY_RICCN  "RecName: Full=Protein cyaY;"

OrgPattern -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111-----------------------------1-------------------------------------------------------------------------------------------------------------------------1-----1------1-------------------1111-----------------------------------1-111-1-------11----11---------111111111111-------------------11-1------1--1---------------------------------------1111-----11-11------------------------------------------------------------------------- --------21-----1-11------------------------------111111111-111111111-1---1-111111---1--1-1-------1---1--------21-1-2--------1---------------1---------------111---12----------1-11--1-1-----1111--1---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNNSEFSKIAETTIAYIAEKIEEQDKEASIDVDLQGDILNLDTDKGVYVINKQSAAKEIW:Sequence :ccHHHHHHHHHHHHHHHHHHHHHHTTcTTcEEEEETTEEEEcTTccEEEEEEEGGGTEEE:Sec Str : ############:PROS|49->63|PS01344|FRATAXIN_1|PDOC01043| :============================================================:RP:SCP|1->99|2fqlA1|2e-25|35.4|99/112|d.82.2.1 :============================================================:BL:SWS|1->103|CYAY_RICCN|2e-56|100.0|103/103 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->95|PF01491|3e-15|50.5|93/107|Frataxin_Cyay 61: . . . * . .: 120 :LSSPVSGPYHFFYEQGEWTNRAGLELMAILTEELNIKFDTRPT :Sequence :EEETTTEEEEEEEccccEETTTcccHHHHHHHHHHHHHTcc :Sec Str :### :PROS|49->63|PS01344|FRATAXIN_1|PDOC01043| :======================================= :RP:SCP|1->99|2fqlA1|2e-25|35.4|99/112|d.82.2.1 :=========================================== :BL:SWS|1->103|CYAY_RICCN|2e-56|100.0|103/103 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|3->95|PF01491|3e-15|50.5|93/107|Frataxin_Cyay