[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAL02981.1 rcon0 cyaY "cyaY protein"
MNNSEFSKIAETTIAYIAEKIEEQDKEASIDVDLQGDILNLDTDKGVYVINKQSAAKEIW
LSSPVSGPYHFFYEQGEWTNRAGLELMAILTEELNIKFDTRPT
//