[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rcon0:dnaE"

dnaE        "DNA polymerase III alpha chain"
DPO3A_RICCN  "RecName: Full=DNA polymerase III subunit alpha;         EC=2.7.7.7;"

OrgPattern -------------------------------------------------------------------- 3222222222222222222-22112222222222222222222232222211242221112222113232111112111111211111111111111112131224141311111111111111111111-111111111111112221122211221111111121222211111111111121111111211111111111111121111112111111111111111111111111111111111112111111111111111111211111111111111111111111111111111111111111111111111111111211211111111111111-2111112111111111111211111111212322211111222223222222222122221213122223222322-3442332333232322232221222221111111124221211111111111111111111111111111111222212221242532232222333223222224222221122223422222231222211111111111111222222131111111111121211112122222212111111111111111111111111122111222121112111111111112112111111122111111111111111111111111-11111111111111111111111111111111111111211111111111111112112222111111111111111121211111111111-11111111111111111222222222222222221111111111111111111222222222222222111111111111111111111111111111-11111111111111111111111111111121 -------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------1--------------3---------- --------------1-----------------------------------------------------------------1---------------------------------------------1------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRPEFIHLRTQSSYSFLESALTIEKVVELASSNKMPAICLADKGNLFGSLEFALCAVKKG:Sequence :cEEEccccccccTTcTTTccccHHHHHHHHHHHcccEEEEEEETccTTHHHHHHHHHTTT:Sec Str : ==========:RP:SCP|51->156|1q16B|4e-10|10.6|104/509|d.58.1.5 :============================================================:BL:SWS|1->1181|DPO3A_RICCN|0.0|100.0|1181/1181 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->136|PF02811|2e-08|38.3|120/177|PHP 61: . . . * . .: 120 :LQPIHGVILNIKYDIDIFAQILLIAKDETGYKNLLKLSSLTFTKNDRKICDHIDFEDLIE:Sequence :cEEEEEEEEEEEcccTTEEEEEEEEccHHHHHHHHHHHHHHHHTccccccEEEcHHHHHH:Sec Str :============================================================:RP:SCP|51->156|1q16B|4e-10|10.6|104/509|d.58.1.5 :============================================================:BL:SWS|1->1181|DPO3A_RICCN|0.0|100.0|1181/1181 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->136|PF02811|2e-08|38.3|120/177|PHP 121: . . + . . .: 180 :YQEGLIGLCCYTDGIVGKCLLARNEEQAMLFARKLQEILGDRFYFEIMRHELPEEQFIED:Sequence :TcTTEEEEcccTTcHHHHHHHTTcHHHHHHHHHHHHHHHGGGEEEEEcccccHHHHHHHH:Sec Str :==================================== :RP:SCP|51->156|1q16B|4e-10|10.6|104/509|d.58.1.5 :============================================================:BL:SWS|1->1181|DPO3A_RICCN|0.0|100.0|1181/1181 :$$$$$$$$$$$$$$$$ :RP:PFM|8->136|PF02811|2e-08|38.3|120/177|PHP 181: . * . . . .: 240 :SYIRIAAELAIPLVATNKVLFSEKSMHDAHDVLLCISAGVTKEYLDRKTVSENCYFKSPH:Sequence :HHHHHHHHTTccEEEccccccccGGGHHHHHHHHHHHTTcccccccccccccccccccHH:Sec Str :============================================================:BL:SWS|1->1181|DPO3A_RICCN|0.0|100.0|1181/1181 241: + . . . . *: 300 :EMIELFSDLPSAIQNTVNLRERCYFAAHANPPMLPNFATENISETDLIKKDAKEGLLARL:Sequence :HHHHHccHHHHHHHHHHHHHHTcccccccTTccccccccccccHHHHHHHHHHHHHHHHc:Sec Str : ============:RP:SCP|289->422|1r8nA|1e-30|16.0|119/185|b.42.4.1 :============================================================:BL:SWS|1->1181|DPO3A_RICCN|0.0|100.0|1181/1181 301: . . . . + .: 360 :ATKFKSENIALENQEALKTEYFARLNYELDIICNMNFAGYFLIVSDFIKWSKKEGILVGP:Sequence :TTTccHHHHTTTTccccHHHHHHHHHHHHHHHHHHTcHHHHHHHHHHHHHHHTTTccccc:Sec Str :============================================================:RP:SCP|289->422|1r8nA|1e-30|16.0|119/185|b.42.4.1 :============================================================:BL:SWS|1->1181|DPO3A_RICCN|0.0|100.0|1181/1181 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|303->712|PF07733|e-126|56.9|399/428|DNA_pol3_alpha 361: . . . * . .: 420 :GRGSGAGSVVAWSLLITDLDPIKFGLLFERFLNPERISMPDFDIDFCQERREEVINYVRS:Sequence :ccGGGGGcHHHHHTTcccccTTTTTccHHHHccTTcccccccEEEEETTTHHHHHHHHHH:Sec Str :============================================================:RP:SCP|289->422|1r8nA|1e-30|16.0|119/185|b.42.4.1 : ======================:RP:SCP|399->490|1fc3A|7e-21|12.0|92/119|a.4.6.3 :============================================================:BL:SWS|1->1181|DPO3A_RICCN|0.0|100.0|1181/1181 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|303->712|PF07733|e-126|56.9|399/428|DNA_pol3_alpha 421: . . + . . .: 480 :KYGNNRVGQIITFGKMQAKAVIKDVARVLSLPYKFADYLTELVPFSAVNPVSLEQAMREV:Sequence :HHcTTTEEEEEEEccccHHHHHHHHHHHTTccHHHHHHHHTTccccccccccTTTTTccc:Sec Str :== :RP:SCP|289->422|1r8nA|1e-30|16.0|119/185|b.42.4.1 :============================================================:RP:SCP|399->490|1fc3A|7e-21|12.0|92/119|a.4.6.3 :============================================================:BL:SWS|1->1181|DPO3A_RICCN|0.0|100.0|1181/1181 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|303->712|PF07733|e-126|56.9|399/428|DNA_pol3_alpha 481: . * . . . .: 540 :PELANAAKGNGLYNLDGEAELIKLVIDTSLILEGLHRHSSTHAAGIVIAGTDLVDIVPVY:Sequence :TTTTTHHHHc HHHHcHHcHHHHHHHHHHHHcTTccccEEEcccEEEEccccGGGTccEE:Sec Str :========== :RP:SCP|399->490|1fc3A|7e-21|12.0|92/119|a.4.6.3 :============================================================:BL:SWS|1->1181|DPO3A_RICCN|0.0|100.0|1181/1181 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|303->712|PF07733|e-126|56.9|399/428|DNA_pol3_alpha 541: + . . . . *: 600 :KDANSDMLIVGYSMKYSEIAGLIKFDFLGLQTLTVITDCKKLLKEQGIEVDFNNMTFDDN:Sequence :EcTTGccEEEEEEHHHHHTTTcEEEEEEEEHHHHHHHHHHHHHHHHcccccGGGccTTcH:Sec Str :============================================================:BL:SWS|1->1181|DPO3A_RICCN|0.0|100.0|1181/1181 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|303->712|PF07733|e-126|56.9|399/428|DNA_pol3_alpha 601: . . . . + .: 660 :KTYQMLCKGKGVGVFQFESIGMKDALRRLKPDSIHDLIALGALYRPGPMENIPTYIACKH:Sequence :HHHHHHHTTccTTcTTcccHHHHHHHHHHccccHHHHHHHHHHccTTGGGHHHHHHHHHT:Sec Str :============================================================:BL:SWS|1->1181|DPO3A_RICCN|0.0|100.0|1181/1181 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|303->712|PF07733|e-126|56.9|399/428|DNA_pol3_alpha 661: . . . * . .: 720 :KLQQPDYLHELLQPILEETYGVVIYQEQVQRIAQVLAGYTLGAADLLRRAMGKKIKKEME:Sequence :TccccccTHHHHHHHHGGGTTccccHHHHHHHHHHHccccHHHHHHHHHHHHHTcTTTHH:Sec Str : XXXXXXXX:SEG|713->728|kkikkemeeqeeifvk : ===================================:RP:SCP|686->825|1kitA2|6e-29|13.4|134/197|b.29.1.8 :============================================================:BL:SWS|1->1181|DPO3A_RICCN|0.0|100.0|1181/1181 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|303->712|PF07733|e-126|56.9|399/428|DNA_pol3_alpha 721: . . + . . .: 780 :EQEEIFVKGAIANNISESQAKSIFATVAKFAGYGFNKAHAASYGVISYQTAYLKANYPAA:Sequence :HHHHHHHHHHHHHccccHHHHHHHHHHHHHTTccccHHHHHHHHHHHHHHHHHHHHcHHH:Sec Str :XXXXXXXX :SEG|713->728|kkikkemeeqeeifvk :============================================================:RP:SCP|686->825|1kitA2|6e-29|13.4|134/197|b.29.1.8 :============================================================:BL:SWS|1->1181|DPO3A_RICCN|0.0|100.0|1181/1181 781: . * . . . .: 840 :FLVACLNLELNNHDKINLFLQEAKDNGIKIIAPNINISEGYFSVKFSDTVIPHSVKPVIP:Sequence :HHHHHHHHTTTcHHHHHHHHHHHHTTcccEEcccTTTcccccEEETTTEEEcccGGGc :Sec Str :============================================= :RP:SCP|686->825|1kitA2|6e-29|13.4|134/197|b.29.1.8 :============================================================:BL:SWS|1->1181|DPO3A_RICCN|0.0|100.0|1181/1181 841: + . . . . *: 900 :RLDRGIQKISKDTVVKPRCDIAGAIIFALGAIKGVTPNFGKLVTDERKARGAFKSITDFI:Sequence : TccTTcccHHHH cccHHHHHHHHHHHHHccccccHHHHH:Sec Str : XXXXXXXXXXXXXX :SEG|861->874|iagaiifalgaikg : ==========================:RP:SCP|875->927|2eduA1|2e-05|20.0|50/91|a.60.2.7 :============================================================:BL:SWS|1->1181|DPO3A_RICCN|0.0|100.0|1181/1181 901: . . . . + .: 960 :ERLPPKSINSKLLENLIKSGCFDELHDNRLQLLSSIPKLLSYSTAYHEEQESNQFSLIKV:Sequence :HHccTTTccHHHHHHHHHHTTTGGGcccHHHHHHHHHHHHHHHHHHHHHHTTcccccccc:Sec Str :=========================== :RP:SCP|875->927|2eduA1|2e-05|20.0|50/91|a.60.2.7 :============================================================:BL:SWS|1->1181|DPO3A_RICCN|0.0|100.0|1181/1181 961: . . . * . .:1020 :SSLSPTILVSSDYADKNTLAFYEFEAMGLFISNHPLTEYQEIFSRLNILNTADLHNNLPD:Sequence :ccccccccccccccHHHHHHHHHHHHHcccccccGGGTcHHHHccccGGGHHHHHcccc :Sec Str : ======================================:RP:SCP|983->1097|1asyA1|9e-13|13.5|111/137|b.40.4.1 :============================================================:BL:SWS|1->1181|DPO3A_RICCN|0.0|100.0|1181/1181 1021: . . + . . .:1080 :GTNRVNLAGVIQKKDSRMSARGRFVTLVLSDPENIFELSIFSEEVLKDYVHLLDVKSLVV:Sequence :cccEEEEEEEEccccEEEEETTEEEEEccTT :Sec Str :============================================================:RP:SCP|983->1097|1asyA1|9e-13|13.5|111/137|b.40.4.1 :============================================================:BL:SWS|1->1181|DPO3A_RICCN|0.0|100.0|1181/1181 1081: . * . . . .:1140 :VNCDIVKDEGGIKLTAKSFSSIEDAINNKQFELQFYPQNHEELRQIVTLLAARINNEDQS:Sequence : :Sec Str :================= :RP:SCP|983->1097|1asyA1|9e-13|13.5|111/137|b.40.4.1 :============================================================:BL:SWS|1->1181|DPO3A_RICCN|0.0|100.0|1181/1181 1141: + . . . . *:1200 :NAKATIYLQSADVKNFVAKITLPEKFLLQGQDFEILKGYSK :Sequence : :Sec Str :========================================= :BL:SWS|1->1181|DPO3A_RICCN|0.0|100.0|1181/1181