[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rcon0:thdF"

thdF        "possible thiophene and furan oxidation protein thdF"
MNME_RICCN  "RecName: Full=tRNA modification GTPase mnmE;         EC=3.6.-.-;"

OrgPattern -------------------------------------------------------------------- 222-1--------------------------------111-----111------111-----1--1-11111-111111121132222222212222122222222222222222222222222222212222222222221112122222222222221122222122221121111111212222222122322222222222222222333322222212222222222222222221222222222222222222212222222222211-12222222222222222222222222222222223222222222222222222222222222322223222122222222222333232222242233223211112222122222222222211111111111-2222212211121111111111112112222222221222222222211122222222222222211111111111111122221111112222222222222222222222222222222222222211211122121222222221111112111112222324222222222222221221211112-22222221111122222222222222211112322222212222222222222222222112221211111122222222222222222-22222222222222222222221122222221122112222221222222211122222222222112211111111112121222222222222222222222122222222222222222222221111111111222211111222222222222223112112222222222221221222121223-33222122221222221113233222222222 11--121-1------11111111111111111111111111111111111111121111111111111111111111-1111111111-1311111----111111-1312111113-11-11121111292-112-1111111-111-111121---113-1111-111311113123F333321112131133-322 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :METIFAQSSAFGKAGVAVFRISGPKSLEVLQLLTGRKDFKSRLMYYQQITVPETKELIDN:Sequence :cccEEEEcccccccccEEEEEEcccHHHHHHTEEEccccccTccEEEEEc cccccccE:Sec Str :============================================================:RP:SCP|1->119|1xzpA3|5e-38|42.2|116/117|d.250.1.2 :============================================================:BL:SWS|1->445|MNME_RICCN|0.0|100.0|445/445 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->119|PF10396|1e-27|54.8|115/117|TrmE_N 61: . . . * . .: 120 :VMVVYFKSPGSFTGEDVVEIHTHGSKAISIMLTNALLNIAGIRLAEAGEFTKRAFLNNKF:Sequence :EEEEETTTcccccHHHHHHHHHHHHHHHHHHHHHHHHTHHTccccccHHHcTTccccccc:Sec Str :=========================================================== :RP:SCP|1->119|1xzpA3|5e-38|42.2|116/117|d.250.1.2 : ==:RP:SCP|119->307|1ahjB|6e-23|9.7|186/212|b.34.4.4 :============================================================:BL:SWS|1->445|MNME_RICCN|0.0|100.0|445/445 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|3->119|PF10396|1e-27|54.8|115/117|TrmE_N 121: . . + . . .: 180 :DLTAAEGIADLINAETIMQHKQAIRQASGKLEALYNNWRSQLLKMLSLLEAYIDFPDEDI:Sequence :cccTTcccccccccTTTTHHHHHHHHHHHTccccHHHHHHHHHTccHHHHHHccHHHHHH:Sec Str :============================================================:RP:SCP|119->307|1ahjB|6e-23|9.7|186/212|b.34.4.4 :============================================================:BL:SWS|1->445|MNME_RICCN|0.0|100.0|445/445 181: . * . . . .: 240 :PDTVLNEVTNTHTILVNTISEYLNDNRKGELLRSGLKLAIIGPPNVGKSSLLNFLMQRDI:Sequence :HHHHHHHTTcccHHHHHHHHTccccccccccccccccccccccccTTcEEEEcccccccc:Sec Str :============================================================:RP:SCP|119->307|1ahjB|6e-23|9.7|186/212|b.34.4.4 :============================================================:BL:SWS|1->445|MNME_RICCN|0.0|100.0|445/445 : $$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|216->309|PF02421|2e-05|31.5|92/188|FeoB_N 241: + . . . . *: 300 :AIVSNIAGTTRDIIEGHLDIGGYPIILQDTAGIREESSDIIEQEGIKRAINSAKTADIKI:Sequence :cccccccGGGTTcEEEEEEEcccccccHHHHTTTccccccEEEEEEEHHHHHTTcccccE:Sec Str :============================================================:RP:SCP|119->307|1ahjB|6e-23|9.7|186/212|b.34.4.4 :============================================================:BL:SWS|1->445|MNME_RICCN|0.0|100.0|445/445 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|216->309|PF02421|2e-05|31.5|92/188|FeoB_N 301: . . . . + .: 360 :IMFDAEKLDSSINEDIINLIDENTITIINKIDLIEASKIFSIENKYKCLRVSVKNNIALS:Sequence :EEEEETcTTccHHHHHHHTTTccEEEEEccTTTccHHHHHHHHTTcccEEccTTTTcTHH:Sec Str : XXXXXXXXXXXXXXXXXX :SEG|312->329|inediinlidentitiin :======= :RP:SCP|119->307|1ahjB|6e-23|9.7|186/212|b.34.4.4 : ===============================:RP:SCP|330->442|2iolA1|1e-14|9.3|107/127|a.118.1.14 :============================================================:BL:SWS|1->445|MNME_RICCN|0.0|100.0|445/445 :$$$$$$$$$ :RP:PFM|216->309|PF02421|2e-05|31.5|92/188|FeoB_N 361: . . . * . .: 420 :SILKNIENIAENMAGFTETPYITNQRHRNYLQQALSHLTAFSLDNDLVLATEDIRMTARC:Sequence :HHHHHHHHHHHHHHHHHHHHHHHHHHTTHHHHHHHHHHHHHHHHHHHHHHccccHHHHHH:Sec Str :============================================================:RP:SCP|330->442|2iolA1|1e-14|9.3|107/127|a.118.1.14 :============================================================:BL:SWS|1->445|MNME_RICCN|0.0|100.0|445/445 421: . . + . . .: 480 :IGAITGVINVEEILGEIFKNFCIGK :Sequence :HHHHHTccccHHHHHHHHTTccTTc :Sec Str :====================== :RP:SCP|330->442|2iolA1|1e-14|9.3|107/127|a.118.1.14 :========================= :BL:SWS|1->445|MNME_RICCN|0.0|100.0|445/445