[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAL03713.1 rcon0 thdF "possible thiophene and furan oxidation protein thdF"
METIFAQSSAFGKAGVAVFRISGPKSLEVLQLLTGRKDFKSRLMYYQQITVPETKELIDN
VMVVYFKSPGSFTGEDVVEIHTHGSKAISIMLTNALLNIAGIRLAEAGEFTKRAFLNNKF
DLTAAEGIADLINAETIMQHKQAIRQASGKLEALYNNWRSQLLKMLSLLEAYIDFPDEDI
PDTVLNEVTNTHTILVNTISEYLNDNRKGELLRSGLKLAIIGPPNVGKSSLLNFLMQRDI
AIVSNIAGTTRDIIEGHLDIGGYPIILQDTAGIREESSDIIEQEGIKRAINSAKTADIKI
IMFDAEKLDSSINEDIINLIDENTITIINKIDLIEASKIFSIENKYKCLRVSVKNNIALS
SILKNIENIAENMAGFTETPYITNQRHRNYLQQALSHLTAFSLDNDLVLATEDIRMTARC
IGAITGVINVEEILGEIFKNFCIGK
//