[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rmet0:ABF06949.1"

            "Allophanate hydrolase subunit 2"
            ""

OrgPattern ------------------------------------------------------1111111------- --2-21-21111-121111-11111211111112222465111-2111-21-322112--11211112111--------11----------------------11-------------------------------111-----11---1----------------1----------------11-11---2-1111-1111111111111111111111111--------1222222222222222222222-------1-------------1-------------------------------------------------1--1-----------111---------1--1-----1--11-111-11----111------1231211122212------------22122222--1-5224222432--2211-112111112121222222111111-1-----------------------------1-1---221121223312222222212222112321321--112--1--21-223--11--11----1111221-11--1-1-----------------------11-1-----11111-----------11------211211-1111111-------1----12-----11------1235-121111111111-11111111111111111111214311111111111111111112111---1--111111111111---1---------11-11-------111--11-22222111-11233331224322221443111-11111111111111111111--1--------------------------------------------------------------------1- ---------------1-11111121-1----------------111---21222111-----211111111121111--1111111---111-----11-1---------------------------------------------------------------------------11-----11----1--------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MIEIIRPGAQASVQDLGRVGFRRFGVGRSGAADDLALRVGNRLLGNDPGAAAIEFTLGRA:Sequence : XXXXXXXXXXXX :SEG|17->28|grvgfrrfgvgr :============================================================:BL:SWS|1->321|YBGK_ECOLI|8e-80|52.8|305/310 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|29->300|PF02626|5e-62|55.1|265/271|AHS2 61: . . . * . .: 120 :AVRFEADMRVALTGAECSANLDGVPVWSWHAFDVRRGETLTLPSPRGGTRTYLCVAGGID:Sequence :============================================================:BL:SWS|1->321|YBGK_ECOLI|8e-80|52.8|305/310 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|29->300|PF02626|5e-62|55.1|265/271|AHS2 121: . . + . . .: 180 :VPLVMNSRSTDLKSGFGGFEGRVLREGDRLPVGRPGIEQGQDWVGVAAPGWALPGQDGGN:Sequence :============================================================:BL:SWS|1->321|YBGK_ECOLI|8e-80|52.8|305/310 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|29->300|PF02626|5e-62|55.1|265/271|AHS2 181: . * . . . .: 240 :AIAIRLLPGPEYADFEPASQAALWQSEWTITPQSNRMGLRLQGPALARRAERSADLLSHG:Sequence :============================================================:BL:SWS|1->321|YBGK_ECOLI|8e-80|52.8|305/310 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|29->300|PF02626|5e-62|55.1|265/271|AHS2 241: + . . . . *: 300 :VVPGVMQVPPSGQPIALMSDAQTTGGYPKIGTVIGADLWRLAQVPLGATVRFRQVTLEEA:Sequence :============================================================:BL:SWS|1->321|YBGK_ECOLI|8e-80|52.8|305/310 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|29->300|PF02626|5e-62|55.1|265/271|AHS2 301: . . . . + .: 360 :AAAQAEVDRYLRQIDQALAWQRDGMQIAARRRATTRFVA :Sequence : XXXXXXXXX :SEG|328->336|aarrrattr :===================== :BL:SWS|1->321|YBGK_ECOLI|8e-80|52.8|305/310