[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABF06949.1 rmet0 ABF06949.1 "Allophanate hydrolase subunit 2"
MIEIIRPGAQASVQDLGRVGFRRFGVGRSGAADDLALRVGNRLLGNDPGAAAIEFTLGRA
AVRFEADMRVALTGAECSANLDGVPVWSWHAFDVRRGETLTLPSPRGGTRTYLCVAGGID
VPLVMNSRSTDLKSGFGGFEGRVLREGDRLPVGRPGIEQGQDWVGVAAPGWALPGQDGGN
AIAIRLLPGPEYADFEPASQAALWQSEWTITPQSNRMGLRLQGPALARRAERSADLLSHG
VVPGVMQVPPSGQPIALMSDAQTTGGYPKIGTVIGADLWRLAQVPLGATVRFRQVTLEEA
AAAQAEVDRYLRQIDQALAWQRDGMQIAARRRATTRFVA
//