[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "rmet0:ABF06971.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111-11111111111111111111--111111--------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MQMIYNSDNYCIVEFGADVEHATLASGGYEIVDKNLKREIFLGGLMAETFRADVTRLIES:Sequence :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->85|PF12091|5e-29|62.4|85/85|DUF3567 61: . . . * . .: 120 :EPSVEEVDEFLGKFDTVMNNPLVMH :Sequence :$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|1->85|PF12091|5e-29|62.4|85/85|DUF3567