[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABF06971.1 rmet0 ABF06971.1 "conserved hypothetical protein"
MQMIYNSDNYCIVEFGADVEHATLASGGYEIVDKNLKREIFLGGLMAETFRADVTRLIES
EPSVEEVDEFLGKFDTVMNNPLVMH
//